Recombinant human IL-4 protein
Source
e coli.-derived, PGEX-4T
Tag
GST
Format
Liquid
Cat no : Ag9871
Synonyms
IL4, IL-4, B-cell stimulatory factor 1, BSF-1, IL 4
Validation Data Gallery View All
Product Information
| Peptide Sequence |
GHKCDITLQEIIKTLNSLTEQKTLCTELTVTDIFAASKNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKCSS
(24-153 aa encoded by BC070123) |
| Activity | Not tested. |
| Endotoxin Level | Please contact the lab for more information. |
