• Featured Product
  • KD/KO Validated

IL-4 Monoclonal antibody

IL-4 antibodies are versatile tools for investigating IL-4’s roles in immunity, allergy, autoimmunity, and cancer, supporting a wide range of molecular, cellular, and functional assays. Proteintech has an extensive range of validated IL-4 antibodies antibodies for WB, IHC, IF-P, ELISA and more.

Cat No. 66142-1-Ig
Clone No.1G2C5

Host / Isotype

Mouse / IgG2a

Reactivity

human, pig and More (3)

Applications

WB, IHC, IF-P, FC (Intra), ELISA

IL4, 1G2C5, B-cell stimulatory factor 1, BSF-1, IL 4

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite®594
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inJurkat cells
Positive IHC detected inhuman tonsillitis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inhuman breast cancer tissue
Positive FC (Intra) detected inRamos cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunohistochemistry (IHC)IHC : 1:20-1:200
Immunofluorescence (IF)-PIF-P : 1:200-1:800
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66142-1-Ig targets IL-4 in WB, IHC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, pig samples.

Tested Reactivity human, pig
Cited Reactivityhuman, mouse, rat, pig, bovine
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag9940

Product name: Recombinant human IL-4 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 24-153 aa of BC070123

Sequence: GHKCDITLQEIIKTLNSLTEQKTLCTELTVTDIFAASKNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKCSS

Predict reactive species
Full Name interleukin 4
Calculated Molecular Weight 153 aa, 17 kDa
Observed Molecular Weight 18 kDa
GenBank Accession NumberBC070123
Gene Symbol IL-4
Gene ID (NCBI) 3565
RRIDAB_2881539
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP05112
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

IL4 is a cytokine produced by CD4+ T cells in response to helminthes and other extracellular parasites. It promotes the proliferation and differentiation of antigen presenting cells. IL4 also plays a pivotal role in antibody isotype switching and stimulates the production of IgE. This cytokine has been applied in the treatment of autoimmune disorder like multiple myeloma, cancer, psoriasis, and arthritis. IL4 has also been extensively applied to inhibit detrimental effect of Th1. It may promote the growth of epithelial tumors by mediating increased proliferation and survival.

Protocols

Product Specific Protocols
FC protocol for IL-4 antibody 66142-1-IgDownload protocol
IF protocol for IL-4 antibody 66142-1-IgDownload protocol
IHC protocol for IL-4 antibody 66142-1-IgDownload protocol
WB protocol for IL-4 antibody 66142-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanIHC

Adv Sci (Weinh)

SMYD3 Promotes Immune Evasion in Clear Cell Renal Cell Carcinoma via SREBP1-Mediated Transactivation of CD47

Authors - Zhengfang Liu
mouseWB

Adv Healthc Mater

One-Step Synthesis of Multifunctional Chitosan Hydrogel for Full-Thickness Wound Closure and Healing.

Authors - Shen Guo
ratWB

Aging (Albany NY)

Integrative transcriptomic and metabonomic profiling analyses reveal the molecular mechanism of Chinese traditional medicine huankuile suspension on TNBS-induced ulcerative colitis.

Authors - Zhenglan Han
ratWB

Transl Stroke Res

Beneficial Effects of Theta-Burst Transcranial Magnetic Stimulation on Stroke Injury via Improving Neuronal Microenvironment and Mitochondrial Integrity.

Authors - Xuemei Zong

Int Immunopharmacol

Favipiravir ameliorates bleomycin-induced pulmonary fibrosis by reprogramming M1/M2 macrophage polarization

Authors - Ruiqin Zhang
mouse

Int Immunopharmacol

Emu oil alleviates atopic dermatitis-like responses by inhibiting Cdc42 signaling of keratinocyte

Authors - Lingwei Bu
Loading...
||
New chat

Able

正在加载,请稍候...