• Featured Product
  • KD/KO Validated

INO80B Polyclonal antibody

INO80B Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 29488-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

Human, mouse

Applications

WB, IHC, IF/ICC, ELISA

hIes2, HMGA1L4, HMGIYL4, IES2, INO80 complex subunit B, INO80B, PAP 1 associated protein 1, PAP 1BP, PAPA 1, PAPA1, ZNHIT4

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inJurkat cells, HeLa cells, MCF-7 cells
Positive IHC detected inmouse ovary tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

29488-1-AP targets INO80B in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human, mouse samples.

Tested Reactivity Human, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag30345

Product name: Recombinant human INO80B protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 29-265 aa of BC050666

Sequence: HGHGVHKKKHKKHKKKHKKKHHQEEDAGPTQPSPAKPQLKLKIKLGGQVLGTKSVPTFTVIPEGPRSPSPLMVVDNEEEPMEGVPLEQYRAWLDEDSNLSPSPLRDLSGGLGGQEEEEEQRWLDALEKGELDDNGDLKKEINERLLTARQRALLQKARSQPSPMLPLPVAEGCPPPALTEEMLLKREERARKRRLQAARRAEEHKNQTIERLTKTAATSGRGGRGGARGERRGGRA

Predict reactive species
Full Name INO80 complex subunit B
Calculated Molecular Weight 356 aa, 39 kDa
Observed Molecular Weight45-50 kDa
GenBank Accession NumberBC050666
Gene Symbol INO80B
Gene ID (NCBI) 83444
RRIDAB_2918316
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9C086
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

INO80B (INO80 complex subunit B), also known as ZNHIT4 (zinc finger HIT domain-containing protein 4), PAPA1 (PAP-1-associated protein 1), is a subunit of the chromatin remodeling INO80 complex which is involved in transcriptional regulation, DNA replication and probably DNA repair. INO80B is localized to the nucleolus. The function of INO80B is to induce growth arrest by haulting the cell cycle at the G1 phase. INO80B expression is controlled at the transcriptional level and is highest at the G0 and G1 phases of the cell cycle. In vitro, INO80B binds PAP-1, a splicing factor, and may play a role in nucleolar complexes that regulate ribosome biogenesis and cell cycle events.

Protocols

Product Specific Protocols
WB protocol for INO80B antibody 29488-1-APDownload protocol
IHC protocol for INO80B antibody 29488-1-APDownload protocol
IF protocol for INO80B antibody 29488-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...