ISCA2 Polyclonal antibody

• 

  WB analysis using 13200-1-AP

  A431 cells were subjected to SDS PAGE followed by western blot with 13200-1-AP (ISCA2 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human liver cancer using 13200-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 13200-1-AP (ISCA2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver cancer using 13200-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 13200-1-AP (ISCA2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human breast cancer using 13200-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 13200-1-AP (ISCA2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human breast cancer using 13200-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 13200-1-AP (ISCA2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of A431 using 13200-1-AP

  Immunofluorescent analysis of (4% PFA) fixed A431 cells using 13200-1-AP (ISCA2 antibody), at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

ISCA2 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 13200-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

ISA2, Iron-sulfur cluster assembly 2 homolog, mitochondrial, HESB-like domain-containing protein 1, HBLD1, c14_5557

---

Tested Applications

• Positive WB detected in: A431 cells
• Positive IHC detected in: human liver cancer tissue, human breast cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: A431 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below
• IHC: See 1 publications below

Product Information

13200-1-AP targets ISCA2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3941

  Product name: Recombinant human ISCA2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-154 aa of BC032893

  Sequence: MAAAWGSSLTAATQRAVTPWPRGRLLTASLGPQARREASSSSPEAGEGQICLTDSCVQRLLEITEGSEFLRLQVEGGGCSGFQYKFSLDTVINPDDRVFEQGGARVVVDSDSLAFVKGAQVDFSQELIRSSFQVLNNPQAQQGCSCGSSFSIKL

• Full Name: iron-sulfur cluster assembly 2 homolog (S. cerevisiae)
• Calculated Molecular Weight: 154 aa, 16 kDa
• Observed Molecular Weight: 16 kDa
• GenBank Accession Number: BC032893
• Gene Symbol: ISCA2
• Gene ID (NCBI): 122961
• RRID: AB_2877924
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q86U28
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC	Sci Rep; Systematic analysis of expression profiles and prognostic significance for MMDS-related iron–sulfur proteins in renal clear cell carcinoma; Authors - Ling Yang
mouse	WB	Neurosci Bull; Intermittent Theta Burst Stimulation Attenuates Cognitive Deficits and Alzheimer's Disease-Type Pathologies via ISCA1-Mediated Mitochondrial Modulation in APP/PS1 Mice; Authors - Yang Zhu