• Featured Product
  • KD/KO Validated

ISG15 Polyclonal antibody

ISG15 Polyclonal Antibody for WB, IHC, IF/ICC, IF-P, ELISA
Cat No. 15981-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (3)

Applications

WB, IHC, IF/ICC, IF-P, IP, CoIP, RIP, ELISA

G1P2, hUCRP, IFI15, Interferon-induced 15 kDa protein, Interferon-induced 17 kDa protein

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, human brain tissue, A549 cells, MCF-7 cells, PC-3 cells, IFN alpha treated A459 cells, HepG2 cells, IFN alpha treated HepG2 cells
Positive IHC detected inhuman lung cancer tissue, human pancreas cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse brain tissue
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

15981-1-AP targets ISG15 in WB, IHC, IF/ICC, IF-P, IP, CoIP, RIP, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse, pig, monkey, goat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag8782

Product name: Recombinant human ISG15 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-165 aa of BC009507

Sequence: MGWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPLASQGLGPGSTVLLVVDKCDEPLNILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFMNLRLRGGGTEPGGRS

Predict reactive species
Full Name ISG15 ubiquitin-like modifier
Calculated Molecular Weight 165 aa, 18 kDa
Observed Molecular Weight 15-17 kDa
GenBank Accession NumberBC009507
Gene Symbol ISG15
Gene ID (NCBI) 9636
RRIDAB_2126302
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP05161
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ISG15 is a ubiquitin-like protein that becomes conjugated to many cellular proteins upon activation by interferon-alpha (IFNA) and -beta (IFNB). ISG15 forms covalent conjugates with its target proteins in a process called ISGylation, which in mammals is known to play a role in antiviral immunity. ISG15 proteins possess two ubiquitin-like (UBL) domains and a highly conserved C-terminal LRGG sequence, the latter being known as the ubiquitin conjugation motif. Intracellular ISG15 are conjugated, via the LRGG motif, to target proteins through a process called ISGylation, which resembles largely ubiquitination, the process of formation of ubiquitin conjugates. Unconjugated extracellular ISG15, which are released from several types of human and murine cells, are known to possess cytokine-like activity.

Protocols

Product Specific Protocols
IF protocol for ISG15 antibody 15981-1-APDownload protocol
IHC protocol for ISG15 antibody 15981-1-APDownload protocol
WB protocol for ISG15 antibody 15981-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Signal Transduct Target Ther

TRAF3 activates STING-mediated suppression of EV-A71 and target of viral evasion

Authors - Wenwen Zheng
mouse,humanWB,IP,IHC

Exp Mol Med

SIRT1 ISGylation accelerates tumor progression by unleashing SIRT1 from the inactive state to promote its deacetylase activity

Authors - Ji An Kang
humanIF

Nat Commun

Single cell RNA sequencing of human microglia uncovers a subset associated with Alzheimer's disease.

Authors - Marta Olah
humanWB

Nat Commun

ISGylation controls exosome secretion by promoting lysosomal degradation of MVB proteins.

Authors - Carolina Villarroya-Beltri
humanWB,IHC,IF,CoIP

J Exp Clin Cancer Res

ISG15 and ISGylation modulates cancer stem cell-like characteristics in promoting tumor growth of anaplastic thyroid carcinoma

Authors - Tong Xu
  • KD Validated
humanWB

Cancer Lett

Induction of IFIT1/IFIT3 and inhibition of Bcl-2 orchestrate the treatment of myeloma and leukemia via pyroptosis

Authors - Yuanming He

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Tinne (Verified Customer) (06-27-2023)

This antibody worked really well for detecting an up regulation of ISG15 in IF. Highly recommend!

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Human hippocampal progenitor cells
FH

Chaohui (Verified Customer) (10-19-2021)

The antibody shows a high quality of free ISG15 and conjugated ISG15 spots

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: HEK293, THP1
Loading...
||
New chat Able
正在加载,请稍候...