Recombinant mouse IL-4 protein
Source
e coli.-derived, PET28a
Tag
6*His
Format
Liquid
Cat no : Ag24492
Synonyms
IL-4, Il 4, Il4, interleukin 4, cytokine
Validation Data Gallery View All
Product Information
| Peptide Sequence |
HIHGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLTATKNTTESELVCRASKVLRIFYLKHGKTPCLKKNSSVLMELQRLFRAFRCLDSSISCTMNESKSTSLKDFLESLKSIMQMDYS
(21-140 aa encoded by NM-021283) |
| Activity | Not tested. |
| Endotoxin Level | Please contact the lab for more information. |
