JAK2 Polyclonal antibody

• 

  WB analysis of NIH/3T3 using 17670-1-AP

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 17670-1-AP (JAK2 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IP experiment of NIH/3T3 using 17670-1-AP

  IP result of anti-JAK2 (IP:17670-1-AP, 4ug; Detection:17670-1-AP 1:300) with NIH/3T3 cells lysate 3440 ug.

• 

  IHC staining of human kidney using 17670-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 17670-1-AP (JAK2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human kidney using 17670-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 17670-1-AP (JAK2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human breast cancer using 17670-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 17670-1-AP (JAK2 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human breast cancer using 17670-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 17670-1-AP (JAK2 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

JAK2 Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 17670-1-AP

Publications(102)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (3)

Applications

WB, IHC, IF, IP, CoIP, ELISA

Synonyms

Tyrosine protein kinase JAK2, JTK10, Janus kinase 2, JAK-2, JAK 2

---

Tested Applications

• Positive WB detected in: NIH/3T3 cells
• Positive IP detected in: NIH/3T3 cells
• Positive IHC detected in: human kidney tissue, human breast cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 3 publications below
• WB: See 93 publications below
• IHC: See 5 publications below
• IF: See 2 publications below
• IP: See 1 publications below
• CoIP: See 1 publications below

Product Information

17670-1-AP targets JAK2 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse, rat, pig, zebrafish
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11264

  Product name: Recombinant human JAK2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 764-1129 aa of BC039695

  Sequence: EDRHQLPAPKWAELANLINNCMDYEPDFRPSFRAIIRDLNSLFTPDYELLTENDMLPNMRIGALGFSGAFEDRDPTQFEERHLKFLQQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIEILKSLQHDNIVKYKGVCYSAGRRNLKLIMEYLPYGSLRDYLQKHKERIDHIKLLQYTSQICKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEYYKVKEPGESPIFWYAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPAEFMRMIGNDKQGQMIVFHLIELLKNNGRLPRPDGCPDEIYMIMTECWNNNVNQRPSFRDLALRVDQIRDNMAG

• Full Name: Janus kinase 2 (a protein tyrosine kinase)
• Calculated Molecular Weight: 1132 aa, 130 kDa
• Observed Molecular Weight: 120-130 kDa
• GenBank Accession Number: BC039695
• Gene Symbol: JAK2
• Gene ID (NCBI): 3717
• RRID: AB_2811138
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O60674
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Janus kinases (JAKs) are non-receptor tyrosine kinases that are activated by cytokine binding to cytokine receptors resulting in stimulation of the JAK-STAT signaling pathway. Aberrant activation of this signaling pathway is associated with numerous immune disorders and cancer.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
rat	WB	Adv Healthc Mater; Dual-Barb Microneedle with JAK/STAT Inhibitor-Loaded Nanovesicles Encapsulation for Tendinopathy; Authors - Minhao Chen
mouse	WB	J Neuroinflammation; Kynurenic acid blunts A1 astrocyte activation against neurodegeneration in HIV-associated neurocognitive disorders; Authors - Jingxian Lun
human	WB,IP	Cell Death Dis; 4EBP1 senses extracellular glucose deprivation and initiates cell death signaling in lung cancer; Authors - Yanan Wang
mouse	WB	Theranostics; Combination therapy with ropivacaine-loaded liposomes and nutrient deprivation for simultaneous cancer therapy and cancer pain relief.; Authors - Jiqian Zhang
human	WB	Arch Med Res; Extracellular Vesicles from Carcinoma-associated Fibroblasts Promote EMT of Salivary Adenoid Cystic Carcinoma Via IL-6; Authors - Hyat Ahmed Ibrahim Al-Raimi
human	WB	Biomed Pharmacother; Molecular mechanism through which Tripterygium hypoglaucum (Lévl.) Hutch alleviates psoriasis; Authors - Yumei Sun

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Carly (Verified Customer) (11-17-2020)

Tested using EDTA plasma on an antibody microarray

• Applications: Other