JUN Monoclonal antibody

JUN Monoclonal Antibody for WB, ELISA
Cat No. 66313-1-Ig
Clone No.1G6B11

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, ELISA

AP 1, AP1, 1G6B11, Activator protein 1, c Jun

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inMDA-MB-231 cells, ROS1728 cells, Saos-2 cells, HEK-293 cells, NIH/3T3 cells, RKO cells
Positive FC (Intra) detected inNIH/3T3 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66313-1-Ig targets JUN in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag17639

Product name: Recombinant human JUN protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 92-227 aa of BC068522

Sequence: PTPTQFLCPKNVTDEQEGFAEGFVRALAELHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGALSSGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQMPVQHPRLQALKE

Predict reactive species
Full Name jun oncogene
Calculated Molecular Weight 331 aa, 36 kDa
Observed Molecular Weight 39 kDa
GenBank Accession NumberBC068522
Gene Symbol JUN
Gene ID (NCBI) 3725
RRIDAB_2881694
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP05412
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

What is the molecular weight of JUN?

The molecular weight of JUN is approximately 39 kDa.

What is the cellular localization of JUN?

JUN expression can be located in the nucleus. However, ubiquitinated JUN colocalizes with lysosomal proteins (PMID: 15469925).

 What is the function of JUN?

JUN is a basic leucine zipper (bZIP) transcription factor that recognizes and binds to a consensus heptamer motif of 5'-TGA[CG]TCA-3' in the enhancer region of target genes. JUN acts as either a homo- or heterodimer and binds to the DNA to regulate transcriptional activity, specifically promoting the activity of NR5A1 when phosphorylated by HIPK3, leading to increased steroidogenic gene expression upon the stimulation of the cAMP signaling pathway (PMID: 9732876).

 What post-translational modifications is JUN subjected to?

JUN is acetylated at Lys-271 by EP300 (PMID: 11689449). JUN is phosphorylated by PLK3 following exposure to hypoxia or UV irradiation, which leads to increased DNA-binding activity (PMID: 27281822), and also by PAK2 at numerous threonine residues to promote cell proliferation and transformation (PMID: 21177766). JUN is also phosphorylated by DYRK2 at Ser-243, which primes it for subsequent further phosphorylation by GSK3B and reduces its ability to bind DNA (PMID: 22307329).

 What is the role of JUN in disease?

Activation of JUN is linked with proliferation and angiogenesis in invasive breast cancers (PMID: 16733206).


Protocols

Product Specific Protocols
FC protocol for JUN antibody 66313-1-IgDownload protocol
WB protocol for JUN antibody 66313-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseWB

J Hematol Oncol

PMID: 32552902

Authors - Xinhua Xiao
mouse,humanWB

Cell Biol Toxicol

microRNA-149-5p mediates the PM2.5-induced inflammatory response by targeting TAB2 via MAPK and NF-κB signaling pathways in vivo and in vitro.

Authors - Qiuyue Li
humanWB

Genomics

Integrative epigenomic profiling reveal AP-1 is a key regulator in intrahepatich cholangiocarcinoma.

Authors - Ke He
humanWB

Pharmacol Res

CX-5461 is a potent immunosuppressant which inhibits T cell-mediated alloimmunity via p53-DUSP5.

Authors - Guopin Pan
mouseWB

J Cell Physiol

Lack of Mof reduces acute liver injury by enhancing transcriptional activation of Igf1.

Authors - Meng Wang
mouseWB

Front Pharmacol

Azithromycin Attenuates Bleomycin-Induced Pulmonary Fibrosis Partly by Inhibiting the Expression of LOX and LOXL-2.

Authors - Xiang Tong
Loading...
||
New chat Able
正在加载,请稍候...