JUN Monoclonal antibody, PBS Only

JUN Monoclonal Antibody for WB, Indirect ELISA

Cat No. 66313-1-PBS
Clone No.1G6B11

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

AP 1, AP1, 1G6B11, Activator protein 1, c Jun

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

66313-1-PBS targets JUN in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag17639

Product name: Recombinant human JUN protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 92-227 aa of BC068522

Sequence: PTPTQFLCPKNVTDEQEGFAEGFVRALAELHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGALSSGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQMPVQHPRLQALKE

Predict reactive species
Full Name jun oncogene
Calculated Molecular Weight 331 aa, 36 kDa
Observed Molecular Weight 39 kDa
GenBank Accession NumberBC068522
Gene Symbol JUN
Gene ID (NCBI) 3725
RRIDAB_2881694
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP05412
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

What is the molecular weight of JUN?

The molecular weight of JUN is approximately 39 kDa.

What is the cellular localization of JUN?

JUN expression can be located in the nucleus. However, ubiquitinated JUN colocalizes with lysosomal proteins (PMID: 15469925).

 What is the function of JUN?

JUN is a basic leucine zipper (bZIP) transcription factor that recognizes and binds to a consensus heptamer motif of 5'-TGA[CG]TCA-3' in the enhancer region of target genes. JUN acts as either a homo- or heterodimer and binds to the DNA to regulate transcriptional activity, specifically promoting the activity of NR5A1 when phosphorylated by HIPK3, leading to increased steroidogenic gene expression upon the stimulation of the cAMP signaling pathway (PMID: 9732876).

 What post-translational modifications is JUN subjected to?

JUN is acetylated at Lys-271 by EP300 (PMID: 11689449). JUN is phosphorylated by PLK3 following exposure to hypoxia or UV irradiation, which leads to increased DNA-binding activity (PMID: 27281822), and also by PAK2 at numerous threonine residues to promote cell proliferation and transformation (PMID: 21177766). JUN is also phosphorylated by DYRK2 at Ser-243, which primes it for subsequent further phosphorylation by GSK3B and reduces its ability to bind DNA (PMID: 22307329).

 What is the role of JUN in disease?

Activation of JUN is linked with proliferation and angiogenesis in invasive breast cancers (PMID: 16733206).


Loading...
||
New chat

Able

正在加载,请稍候...