GIRK2 Polyclonal antibody

• 

  WB analysis using 21647-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 21647-1-AP (GIRK2 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse brain using 21647-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 21647-1-AP (GIRK2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse brain using 21647-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 21647-1-AP (GIRK2 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 21647-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 21647-1-AP (GIRK2 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

GIRK2 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 21647-1-AP

Publications(4)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF, IHC, ELISA

Synonyms

BIR1, GIRK 2, GIRK2, hiGIRK2, KATP 2, KATP2, KCNJ6, KCNJ7, KIR3.2

---

Tested Applications

• Positive WB detected in: mouse brain tissue, rat brain tissue
• Positive IHC detected in: mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below
• IF: See 1 publications below

Product Information

21647-1-AP targets GIRK2 in WB, IF, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16344

  Product name: Recombinant human KCNJ6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 351-423 aa of BC101547

  Sequence: YNSFHETYETSTPSLSAKELAELASRAELPLSWSVSSKLNQHAELETEEEEKNLEEQTERNGDVANLENESKV

• Full Name: potassium inwardly-rectifying channel, subfamily J, member 6
• Calculated Molecular Weight: 423 aa, 48 kDa
• Observed Molecular Weight: 45-48 kDa
• GenBank Accession Number: BC101547
• Gene Symbol: GIRK2
• Gene ID (NCBI): 3763
• RRID: AB_10794447
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P48051
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GIRK2 (also known as Kir3.2), encoded by KCNJ6 gene, is a member of the G protein-coupled inwardly-rectifying potassium channel (GIRK, Kir3) family of inward rectifier potassium channels. GIRK channels are activated following stimulation of G protein-coupled receptors (PMID: 26422984). They play important roles in regulating cellular excitabilities in the heart and brain (PMID: 31043612). Mutations in KCNJ6 gene are associated with Keppen-Lubinsky Syndrome (PMID: 25620207).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Mol Ther Nucleic Acids; Modulation of miR-181 influences dopaminergic neuronal degeneration in a mouse model of Parkinson's disease.; Authors - Colleen S Stein
mouse	WB	FASEB J; Electro-acupuncture alleviates adolescent cocaine exposure-enhanced anxiety-like behaviors in adult mice by attenuating the activities of PV interneurons in PrL.; Authors - Jiaxun Nie
human	IF	Front Neurosci; Deregulation of mTORC1-TFEB axis in human iPSC model of GBA1-associated Parkinson's disease; Authors - Fahad Mubariz
		Prog Neurobiol; TRPM2 as a conserved gatekeeper determines the vulnerability of DA neurons by mediating ROS sensing and calcium dyshomeostasis; Authors - Peiwu Ye