KEAP1 Fusion Protein

Source

e coli.-derived, PGEX-4T

Tag

GST

Format

Powder

Publications

5

Cat no : Ag0779

Synonyms

INrf2; KIAA0132; KLHL19; MGC10630; MGC1114; MGC20887; MGC4407; MGC9454



Product Information

Peptide Sequence GRLIYTAGGYFRQSLSYLEAYNPSDGTWLRLADLQVPRSGLAGCVVGGLLYAVGGRNNSPDGNTDSSALDCYNPMTNQWSPCAPMSVPRNRIGVGVIDGHIYAVGGSHGCIHHNSVERYEPERDEWHLVAPMLTRRIGVGVAVLNRLLYAVGGFDGTNRLNSAECYYPERNEWRMITAMNTIRSGAGVCVLHNCIYAAGGYDGQDQLNSVERYDVETETWTFVAPMKHRRSALGITVHQGRIYVLGGYDGHTFLDSVECYDPDTDTWSEVTRMTSGRSGVGVAVTMEPCRKQIDQQNCTC
(325-624 aa encoded by BC002930)
Activity Not tested.
Endotoxin Level Please contact the lab for more information.
Purity90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Formulation The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.

Reconstitution and Storage

Reconstitution Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details).
If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used).
Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution.
Shipping The product is shipped at ambient temperature. Upon receipt, store it immediately at the recommended temperature (see below).
Stability and Storage Store for up to 12 months at -20°C to -80°C as lyophilized powder.
Storage of Reconstituted Protein Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Publications

SpeciesTitle

Oxid Med Cell Longev

JFD, a Novel Natural Inhibitor of Keap1 Alkylation, Suppresses Intracellular Mycobacterium Tuberculosis Growth through Keap1/Nrf2/SOD2-Mediated ROS Accumulation

Authors - Haoqiang Wan

Free Radic Biol Med

Rutaecarpine inhibits KEAP1-NRF2 interaction to activate NRF2 and ameliorate dextran sulfate sodium-induced colitis.

Authors - Youbo Zhang

Free Radic Biol Med

BP5 alleviates endotoxemia-induced acute lung injury by activating Nrf2 via dual regulation of the Keap1-Nrf2 interaction and the Akt (Ser473)/GSK3β (Ser9)/Fyn pathway

Authors - Tianxiang Li

Eur J Med Chem

Briarane-type diterpenoids, the inhibitors of osteoclast formation by interrupting Keap1-Nrf2 interaction and activating Nrf2 pathway

Authors - Xinyi Qi

Kidney360

Novel Keap1-Nrf2 Protein-Protein Interaction Inhibitor UBE-1099 Ameliorates Progressive Phenotype in Alport Syndrome Mouse Model

Authors - Shota Kaseda