Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

Sam68 Polyclonal antibody

Sam68 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 10222-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, CoIP, RIP, ELISA

KHDRBS1, GAP-associated tyrosine phosphoprotein p62, KH domain-containing, RNA-binding, signal transduction-associated protein 1, KHDRBS 1, p21 Ras GTPase-activating protein-associated p62

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHEK-293 cells, HeLa cells, HT-29 cells, mouse brain tissue, NIH/3T3 cells, mouse embryo tissue, rat brain tissue
Positive IP detected inHeLa cells
Positive IHC detected inmouse colon tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

10222-1-AP targets Sam68 in WB, IHC, IF/ICC, IP, CoIP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag0235

Product name: Recombinant human Sam68 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 201-442 aa of BC000717

Sequence: GSMRDKAKEEELRKGGDPKYAHLNMDLHVFIEVFGPPCEAYALMAHAMEEVKKFLVPDMMDDICQEQFLELSYLNGVPEPSRGRGVPVRGRGAAPPPPPVPRGRGVGPPRGALVRGTPVRGAITRGATVTRGVPPPPTVRGAPAPRARTAGIQRIPLPPPPAPETYEEYGYDDTYAEQSYEGYEGYYSQSQGDSEYYDYGHGEVQDSYEAYGQDDWNGTRPSLKAPPARPVKGAYREHPYGR

Predict reactive species
Full Name KH domain containing, RNA binding, signal transduction associated 1
Calculated Molecular Weight 48 kDa
Observed Molecular Weight 68 kDa
GenBank Accession NumberBC000717
Gene Symbol Sam68
Gene ID (NCBI) 10657
RRIDAB_2130292
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ07666
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

KHDRBS1, also named as SAM68, p62and p68, belongs to the KHDRBS family. It is recruited and tyrosine phosphorylated by several receptor systems, for example the T-cell, leptin and INS receptors. Once phosphorylated, KHDRBS1 functions as an adapter protein in signal transduction cascades by binding to SH2 and SH3 domain-containing proteins. It represses CBP-dependent transcriptional activation apparently by competing with other nuclear factors for binding to CBP. KHDRBS1 also acts as a putative regulator of mRNA stability and/or translation rates and mediates mRNA nuclear export. KHDRBS1 has three isoforms with calculated MW of 44-48kd. For isoform with a calculated MW of 48.2 kD, it migrated as a 68kD protein on SDS-PAGE gels[PMID: 10564820]. This ia a rabbit polyclonal antibody raised against residues near the N terminus of human Sam68.

Protocols

Product Specific Protocols
IF protocol for Sam68 antibody 10222-1-APDownload protocol
IHC protocol for Sam68 antibody 10222-1-APDownload protocol
IP protocol for Sam68 antibody 10222-1-APDownload protocol
WB protocol for Sam68 antibody 10222-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle
humanIHC

Acta Neuropathol

Transportin 1 accumulates specifically with FET proteins but no other transportin cargos in FTLD-FUS and is absent in FUS inclusions in ALS with FUS mutations.

Authors - Neumann Manuela M
mouseIHC

Brain

Regulatory T cells delay disease progression in Alzheimer-like pathology.

Authors - Cira Dansokho
humanIHC

Theranostics

SAM68 promotes tumorigenesis in lung adenocarcinoma by regulating metabolic conversion via PKM alternative splicing.

Authors - Song Zhu
humanWB,RIP,CoIP

Mol Ther Nucleic Acids

LRRC4 mediates the formation of circular RNA CD44 to inhibitGBM cell proliferation

Authors - Jianbo Feng
humanWB

FASEB J

CircMTA1 promotes glioblastoma angiogenesis by encoding MTA1-134aa

Authors - Ben Niu
mouseWB

Reprod Fertil Dev

Cold-induced RNA-binding protein (CIRBP) regulates the expression of Src-associated during mitosis of 68 kDa (Sam68) and extracellular signal-regulated kinases (ERK) during heat stress-induced testicular injury.

Authors - Chengcheng Xu

Reviews

    4.3 out of 5
Add a review

3 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Aleksandr (Verified Customer) (12-16-2024)

Excellent antibody for Sam68 detection in human cells!

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:3000
  • Cell Tissue Type: RKO
Sam68 Antibody Western Blot validation (1:3000 dilution) in RKO (Cat no:10222-1-AP)

Tsimafei (Verified Customer) (11-19-2024)

Great antibody

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:2000
  • Cell Tissue Type: HEK293T
Sam68 Antibody Western Blot validation (1:2000 dilution) in HEK293T (Cat no:10222-1-AP)

Julia (Verified Customer) (08-07-2024)

Used for 30ug of mESC. Many bands are visible with the thickest one at the correct size. Increasing the dilution should help to obtain cleaner picture.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:3000
  • Cell Tissue Type: mESC
Sam68 Antibody Western Blot validation (1:3000 dilution) in mESC (Cat no:10222-1-AP)
Loading...
||
New chat

Able

正在加载,请稍候...