Tested Applications
| Positive WB detected in | HEK-293 cells, HeLa cells, HT-29 cells, mouse brain tissue, NIH/3T3 cells, mouse embryo tissue, rat brain tissue |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | mouse colon tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
10222-1-AP targets Sam68 in WB, IHC, IF/ICC, IP, CoIP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0235 Product name: Recombinant human Sam68 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 201-442 aa of BC000717 Sequence: GSMRDKAKEEELRKGGDPKYAHLNMDLHVFIEVFGPPCEAYALMAHAMEEVKKFLVPDMMDDICQEQFLELSYLNGVPEPSRGRGVPVRGRGAAPPPPPVPRGRGVGPPRGALVRGTPVRGAITRGATVTRGVPPPPTVRGAPAPRARTAGIQRIPLPPPPAPETYEEYGYDDTYAEQSYEGYEGYYSQSQGDSEYYDYGHGEVQDSYEAYGQDDWNGTRPSLKAPPARPVKGAYREHPYGR Predict reactive species |
| Full Name | KH domain containing, RNA binding, signal transduction associated 1 |
| Calculated Molecular Weight | 48 kDa |
| Observed Molecular Weight | 68 kDa |
| GenBank Accession Number | BC000717 |
| Gene Symbol | Sam68 |
| Gene ID (NCBI) | 10657 |
| RRID | AB_2130292 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q07666 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
KHDRBS1, also named as SAM68, p62and p68, belongs to the KHDRBS family. It is recruited and tyrosine phosphorylated by several receptor systems, for example the T-cell, leptin and INS receptors. Once phosphorylated, KHDRBS1 functions as an adapter protein in signal transduction cascades by binding to SH2 and SH3 domain-containing proteins. It represses CBP-dependent transcriptional activation apparently by competing with other nuclear factors for binding to CBP. KHDRBS1 also acts as a putative regulator of mRNA stability and/or translation rates and mediates mRNA nuclear export. KHDRBS1 has three isoforms with calculated MW of 44-48kd. For isoform with a calculated MW of 48.2 kD, it migrated as a 68kD protein on SDS-PAGE gels[PMID: 10564820]. This ia a rabbit polyclonal antibody raised against residues near the N terminus of human Sam68.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Sam68 antibody 10222-1-AP | Download protocol |
| IHC protocol for Sam68 antibody 10222-1-AP | Download protocol |
| IP protocol for Sam68 antibody 10222-1-AP | Download protocol |
| WB protocol for Sam68 antibody 10222-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The Sam68 Polyclonal antibody (catalog no. 10222-1-AP) has 19 citations. Journals include Signal Transduction and Targeted Therapy, Theranostics, Advanced Science, Brain, Acta Neuropathologica, International Journal of Molecular Medicine, British Journal of Cancer, Environmental Pollution, Molecular Therapy Nucleic Acids, Cancer Biology & Therapy, Translational Oncology, FASEB Journal, Naunyn-Schmiedeberg's Archives of Pharmacology, Journal of Medical Genetics, Food and Chemical Toxicology, Reproduction, Fertility and Development, American Journal of Translational Research, and Hereditas. Research fields span cancer biology, neurodegenerative disease, RNA splicing, autophagy, and stem cell differentiation, mainly using WB and IHC.
| Species | Application | Title |
|---|---|---|
Signal Transduct Target Ther The cryptic lncRNA-encoded microprotein TPM3P9 drives oncogenic RNA splicing and tumorigenesis | ||
Theranostics SAM68 promotes tumorigenesis in lung adenocarcinoma by regulating metabolic conversion via PKM alternative splicing. | ||
Adv Sci (Weinh) Hypoxia-Induced circPRELID2 Promotes Gastric Cancer Metastasis by Facilitating ZEB2 Translation via PCBP1 O-GlcNAcylation | ||
Acta Neuropathol Transportin 1 accumulates specifically with FET proteins but no other transportin cargos in FTLD-FUS and is absent in FUS inclusions in ALS with FUS mutations. | ||
Int J Mol Med CDC5L binds to ELAVL1 to inhibit pyroptosis in hepatocellular carcinoma through the Caspase 3/GSDME signaling pathway. |
Reviews
What customers say
Customers rate this antibody favorably for Western Blot, with two 5-star reviews praising its performance for SAM68 detection in human cells (RKO, HEK293T) at 1:2000–1:3000 dilution. One 3-star review noted that when used with 30 µg of mESC lysate, multiple bands appeared, though the strongest band was at the correct size; the reviewer suggested increasing the dilution for a cleaner result. Overall, the antibody is well-regarded for specificity and signal, with minor optimization recommended for complex samples.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Aleksandr (Verified Customer) (12-16-2024) | Excellent antibody for Sam68 detection in human cells!
 |
Tsimafei (Verified Customer) (11-19-2024) | Great antibody
 |
Julia (Verified Customer) (08-07-2024) | Used for 30ug of mESC. Many bands are visible with the thickest one at the correct size. Increasing the dilution should help to obtain cleaner picture.
 |
