KIRREL2 Polyclonal antibody, PBS Only

• 

  WB analysis of mouse liver using 10890-1-AP (same clone as 10890-1-PBS)

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 10890-1-AP (KIRREL2 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10890-1-PBS in a different storage buffer formulation.

KIRREL2 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 10890-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

Kin of irregular chiasm-like protein 2, Kin of IRRE-like protein 2, NEPH3, Nephrin-like protein 3, UNQ5827/PRO19646

---

Product Information

10890-1-PBS targets KIRREL2 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1036

  Product name: Recombinant human KIRREL2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-219 aa of BC007312

  Sequence: MLRMRVPALLVLLFCFRGRAGPSPHFLQQPEDLVVLLGEGGAQASLGRRASASFSEQKNLMRIPGSSDGSSSRGPEEEETGSREDRGPIVHTDHSDLVLEEEGTLETKDPTNGYYKVRGVSVSLSLGEAPGGGLFLPPPSPLGPPGTPTFYDFNPHLGMVPPCRLYRARAGYLTTPHPRAFTSYIKPTSFGPPDLAPGTPPFPYAAFPTPSHPRLQTHV

• Full Name: kin of IRRE like 2 (Drosophila)
• Calculated Molecular Weight: 75 kDa
• Observed Molecular Weight: 67 kDa, 90 kDa
• GenBank Accession Number: BC007312
• Gene Symbol: KIRREL2
• Gene ID (NCBI): 84063
• RRID: AB_2130842
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6UWL6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.