Recombinant human KRT17 protein
Source
e coli.-derived, PGEX-4T
Tag
GST
Format
Liquid
Cat no : Ag17575
Synonyms
Cytokeratin 17, KRT17, CK 17, CK-17, Cytokeratin,Keratin
Validation Data Gallery View All
Product Information
| Peptide Sequence |
MTTSIRQFTSSSSIKGSSGLGGGSSRTSCRLSGGLGAGSCRLGSAGGLGSTLGGSSYSSCYSFGSGGGYGSSFGGVDGLLAGGEKAT
(1-87 aa encoded by BC000159) |
| Activity | Not tested. |
| Endotoxin Level | Please contact the lab for more information. |
