LIN28A Monoclonal antibody

• 

  WB analysis of NCCIT using 60344-1-Ig

  NCCIT cell were subjected to SDS PAGE followed by western blot with 60344-1-Ig (LIN28 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of NCCIT using 60344-1-Ig

  NCCIT cell were subjected to SDS PAGE followed by western blot with 60344-1-Ig (LIN28 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human prostate cancer using 60344-1-Ig

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 60344-1-Ig (LIN28 Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human prostate cancer using 60344-1-Ig

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 60344-1-Ig (LIN28 Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of human prostate cancer using 60344-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed human prostate cancer tissue using LIN28 antibody (60344-1-Ig, Clone: 4F5G6 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

LIN28A Monoclonal Antibody for WB, IHC, IF-P, ELISA

Cat No. 60344-1-Ig

Clone No.4F5G6

Publications(2)

Host / Isotype

Mouse / IgG1

Reactivity

human and More (1)

Applications

WB, IHC, IF-P, ELISA

Synonyms

Lin-28A, LIN28, Lin 28A, LIN 28, CSDD1

---

Tested Applications

• Positive WB detected in: NCCIT cell
• Positive IHC detected in: human prostate cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: human prostate cancer tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)-P: IF-P : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

60344-1-Ig targets LIN28A in WB, IHC, IF-P, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2312

  Product name: Recombinant human LIN28 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-209 aa of BC028566

  Sequence: MGSVSNQQFAGGCAKAAEEAPEEAPEDAARAADEPQLLHGAGICKWFNVRMGFGFLSMTARAGVALDPPVDVFVHQSKLHMEGFRSLKEGEAVEFTFKKSAKGLESIRVTGPGGVFCIGSERRPKGKSMQKRRSKGDRCYNCGGLDHHAKECKLPPQPKKCHFCQSISHMVASCPLKAQQGPSAQGKPTYFREEEEEIHSPTLLPEAQN

• Full Name: lin-28 homolog (C. elegans)
• Calculated Molecular Weight: 209 aa, 23 kDa
• Observed Molecular Weight: 28 kDa
• GenBank Accession Number: BC028566
• Gene Symbol: LIN28
• Gene ID (NCBI): 79727
• RRID: AB_2881453
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q9H9Z2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

LIN28 is one of the four key human factors (OCT4, SOX2, NANOG and LIN28) used to reprogram human fibroblasts to an embryonic stem (ES) cell-like state known as the induced pluripotent stem (Ips) cell. LIN28 is a marker of undifferentiated human embryonic stem cells and a cytoplasmic mRNA-binding protein that binds to and enhances the translation of the IGF2 mRNA. LIN28 has also been shown to bind to the let-7 pre-miRNA and block production of the mature let-7 microRNA in mouse embryonic stem cells. The calculated molecular weight of LIN28 is 23 kDa, but the modified LIN28 is about 28 kDa.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Oncogene; MSC-regulated lncRNA MACC1-AS1 promotes stemness and chemoresistance through fatty acid oxidation in gastric cancer.; Authors - Wanming He
mouse		J Histochem Cytochem; KIF11 as a Potential Marker of Spermatogenesis Within Mouse Seminiferous Tubule Cross-sections.; Authors - Miki Hara-Yokoyama