CoraLite® Plus 488-conjugated LIN28A Monoclonal antibody

LIN28A Monoclonal Antibody for IF-P
Cat No. CL488-60344
Clone No.4F5G6

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

IF-P

LIN28, Lin-28A, Lin 28A, LIN 28, CSDD1

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inhuman prostate cancer tissue

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-60344 targets LIN28A in IF-P applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag2312

Product name: Recombinant human LIN28 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-209 aa of BC028566

Sequence: MGSVSNQQFAGGCAKAAEEAPEEAPEDAARAADEPQLLHGAGICKWFNVRMGFGFLSMTARAGVALDPPVDVFVHQSKLHMEGFRSLKEGEAVEFTFKKSAKGLESIRVTGPGGVFCIGSERRPKGKSMQKRRSKGDRCYNCGGLDHHAKECKLPPQPKKCHFCQSISHMVASCPLKAQQGPSAQGKPTYFREEEEEIHSPTLLPEAQN

Predict reactive species
Full Name lin-28 homolog (C. elegans)
Calculated Molecular Weight 209 aa, 23 kDa
Observed Molecular Weight 28 kDa
GenBank Accession NumberBC028566
Gene Symbol LIN28
Gene ID (NCBI) 79727
RRIDAB_2919251
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ9H9Z2
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

LIN28 is one of the four key human factors (OCT4, SOX2, NANOG and LIN28) used to reprogram human fibroblasts to an embryonic stem (ES) cell-like state known as the induced pluripotent stem (Ips) cell. Lin28 is a marker of undifferentiated human embryonic stem cells and a cytoplasmic Mrna-binding protein that binds to and enhances the translation of the IGF2 Mrna. LIN28 has also been shown to bind to the let-7 pre-miRNA and block production of the mature let-7 microRNA in mouse embryonic stem cells. The calculated molecular weight of LIN28 is 23 kDa, but the modified LIN28 is about 28 kDa.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 LIN28A antibody CL488-60344Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...