LPCAT2 Monoclonal antibody, PBS Only

• 

  WB analysis using 68476-1-Ig (same clone as 68476-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68476-1-Ig (LPCAT2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control. This data was developed using the same antibody clone with 68476-1-PBS in a different storage buffer formulation.

LPCAT2 Monoclonal Antibody for WB, Indirect ELISA

Cat No. 68476-1-PBS

Clone No.1E6G1

Host / Isotype

Mouse / IgG1

Reactivity

Human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

Acyltransferase like 1, AYTL1, DKFZp686H22112, FLJ20481, LPC acyltransferase 2, LPCAT 2, LPCAT2, Lyso PAF acetyltransferase, LysoPAFAT, LysoPC acyltransferase 2

---

Product Information

68476-1-PBS targets LPCAT2 in WB, Indirect ELISA applications and shows reactivity with Human, mouse, rat samples.

• Tested Reactivity: Human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26420

  Product name: Recombinant human LPCAT2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 340-544 aa of BC002472

  Sequence: EAGLVEFTKISRKLKLDWDGVRKHLDEYASIASSSKGGRIGIEEFAKYLKLPVSDVLRQLFALFDRNHDGSIDFREYVIGLAVLCNPSNTEEIIQVAFKLFDVDEDGYITEEEFSTILQASLGVPDLDVSGLFKEIAQGDSISYEEFKSFALKHPEYAKIFTTYLDLQTCHVFSLPKEVQTTPSTASNKVSPEKHEESTSDKKDD

• Full Name: lysophosphatidylcholine acyltransferase 2
• Calculated Molecular Weight: 60 kDa
• Observed Molecular Weight: 68 kDa
• GenBank Accession Number: BC002472
• Gene Symbol: LPCAT2
• Gene ID (NCBI): 54947
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q7L5N7
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

LPCAT2 (Lysophosphatidylcholine acyltransferase 2) is also named as AGPAT11 and AYTL1. Lipid droplet (LD) content of CRC cells positively correlates with the expression of lysophosphatidylcholine acyltransferase 2 (LPCAT2), an LD-localised enzyme supporting phosphatidylcholine synthesis (PMID: 29358673). Mitochondria play a significant role in ACSL4/LPCAT2-driven ferroptosis (PMID: 3762584). In response to LPS, LPCAT2, but not LPCAT1, rapidly associates with TLR4 and translocates to membrane lipid raft domains to regulate macrophage inflammatory gene expression (PMID: 32587324).