• Featured Product
  • KD/KO Validated

Lamin B1 Polyclonal antibody, PBS Only

Lamin B1 Polyclonal Antibody for WB, IHC, IF/ICC, IF-P, FC (Intra), IP, Indirect ELISA
Cat No. 12987-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IF-P, FC (Intra), IP, Indirect ELISA

LMNB1, laminB1, Lamin-B1, LMN2, LMNB

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

12987-1-PBS targets Lamin B1 in WB, IHC, IF/ICC, IF-P, FC (Intra), IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag3631

Product name: Recombinant human Lamin B1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 237-587 aa of BC012295

Sequence: EYEYKLAQALHEMREQHDAQVRLYKEELEQTYHAKLENARLSSEMNTSTVNSAREELMESRMRIESLSSQLSNLQKESRACLERIQELEDLLAKEKDNSRRMLTDKEREMAEIRDQMQQQLNDYEQLLDVKLALDMEISAYRKLLQGEEERLKLSPSPSSRVTVSRASSSRSVRTTRGKRKRVDVEESEASSSVSISHSASATGNVCIEEIDVDGKFIRLKNTSEQDQPMGGWEMIRKIGDTSVSYKYTSRYVLKAGQTVTIWAANAGVTASPPTDLIWKNQNSWGTGEDVKVILKNSQGEEVAQRSTVFKTTIPEEEEEEEEAAGVVVEEELFHQQGTPRASNRSCAIM

Predict reactive species
Full Name lamin B1
Calculated Molecular Weight 66 kDa
Observed Molecular Weight 66-70 kDa
GenBank Accession NumberBC012295
Gene Symbol Lamin B1
Gene ID (NCBI) 4001
ENSEMBL Gene IDENSG00000113368
RRIDAB_2136290
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP20700
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Lamins are components of the nuclear lamina, a fibrous layer on the nucleoplasmic side of the inner nuclear membrane, which is thought to provide a framework for the nuclear envelope and may also interact with chromatin. The nuclear lamina consists of a two-dimensional matrix of proteins located next to the inner nuclear membrane. The lamin family of proteins make up the matrix and are highly conserved in evolution. During mitosis, the lamina matrix is reversibly disassembled as the lamin proteins are phosphorylated. Vertebrate lamins consist of two types, A and B. This gene encodes one of the two B type proteins, B1. Expression of uncleavable mutant lamin A or B caused significant delays in the onset of chromatin condensation and nuclear shrinkage during apoptosis (PMID:11953316). This protein is not suitable for samples where the nuclear envelope has been removed.

Loading...
||
New chat

Able

正在加载,请稍候...