"Lamin B1 Antibodies" Comparison
View side-by-side comparison of Lamin B1 antibodies from other vendors to find the one that best suits your research needs.
Tested Applications
| Positive WB detected in | HeLa cells, NIH/3T3 cells, HepG2 cells, Jurkat cells, MCF-7 cells, K-562 cells, RAW 264.7 cells, mouse heart tissue, rat heart tissue |
| Positive IP detected in | HeLa cells, rat heart tissue |
| Positive IHC detected in | mouse heart tissue, human colon tissue, human colon cancer tissue, human hepatocellular carcinoma, mouse kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
| Positive FC (Intra) detected in | HEK-293 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:1000-1:4000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
12987-1-AP targets Lamin B1 in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, pig, monkey, chicken, hamster, escherichia coli, bombyx mori |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag3631 Product name: Recombinant human Lamin B1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 237-587 aa of BC012295 Sequence: EYEYKLAQALHEMREQHDAQVRLYKEELEQTYHAKLENARLSSEMNTSTVNSAREELMESRMRIESLSSQLSNLQKESRACLERIQELEDLLAKEKDNSRRMLTDKEREMAEIRDQMQQQLNDYEQLLDVKLALDMEISAYRKLLQGEEERLKLSPSPSSRVTVSRASSSRSVRTTRGKRKRVDVEESEASSSVSISHSASATGNVCIEEIDVDGKFIRLKNTSEQDQPMGGWEMIRKIGDTSVSYKYTSRYVLKAGQTVTIWAANAGVTASPPTDLIWKNQNSWGTGEDVKVILKNSQGEEVAQRSTVFKTTIPEEEEEEEEAAGVVVEEELFHQQGTPRASNRSCAIM Predict reactive species |
| Full Name | lamin B1 |
| Calculated Molecular Weight | 66 kDa |
| Observed Molecular Weight | 66-70 kDa |
| GenBank Accession Number | BC012295 |
| Gene Symbol | Lamin B1 |
| Gene ID (NCBI) | 4001 |
| ENSEMBL Gene ID | ENSG00000113368 |
| RRID | AB_2136290 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P20700 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Lamins are components of the nuclear lamina, a fibrous layer on the nucleoplasmic side of the inner nuclear membrane, which is thought to provide a framework for the nuclear envelope and may also interact with chromatin. The nuclear lamina consists of a two-dimensional matrix of proteins located next to the inner nuclear membrane. The lamin family of proteins make up the matrix and are highly conserved in evolution. During mitosis, the lamina matrix is reversibly disassembled as the lamin proteins are phosphorylated. Vertebrate lamins consist of two types, A and B. This gene encodes one of the two B type proteins, B1. Expression of uncleavable mutant lamin A or B caused significant delays in the onset of chromatin condensation and nuclear shrinkage during apoptosis (PMID:11953316). This protein is not suitable for samples where the nuclear envelope has been removed.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for Lamin B1 antibody 12987-1-AP | Download protocol |
| IF protocol for Lamin B1 antibody 12987-1-AP | Download protocol |
| IHC protocol for Lamin B1 antibody 12987-1-AP | Download protocol |
| IP protocol for Lamin B1 antibody 12987-1-AP | Download protocol |
| WB protocol for Lamin B1 antibody 12987-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The Lamin B1 Polyclonal antibody (Cat# 12987-1-AP) has accumulated 1,791 citations. Publications appear in journals including Nature, Cell, Immunity, Nat Commun, Nat Cell Biol, Cell Metab, Cancer Cell, Nat Immunol, Mol Cell, Autophagy, and Nat Aging. Research fields span oncology, immunology, cell biology, metabolism, neuroscience, genetics, aging, liver disease, microbiome, and nuclear biology, with primary applications in WB, IF, IHC, IP, and ChIP.
| Species | Application | Title |
|---|---|---|
Signal Transduct Target Ther Hypoxia-inducible factor upregulation by roxadustat attenuates drug reward by altering brain iron homoeostasis | ||
Signal Transduct Target Ther Human adipose and umbilical cord mesenchymal stem cell-derived extracellular vesicles mitigate photoaging via TIMP1/Notch1 | ||
Signal Transduct Target Ther Astragaloside IV derivative HHQ16 ameliorates infarction-induced hypertrophy and heart failure through degradation of lncRNA4012/9456 | ||
Signal Transduct Target Ther Serine/threonine/tyrosine kinase 1 drives pancreatic carcinogenesis via GSK3β sequestration-mediated Wnt/β-catenin pathway hyperactivation. | ||
Cancer Cell Exhaustion-associated cholesterol deficiency dampens the cytotoxic arm of antitumor immunity | ||
Reviews
What customers say
All 11 reviews rate this antibody 5 stars. Users consistently report strong, sharp bands in Western Blot across a wide dilution range (1:1,000–1:20,000), with reliable performance in cell lysates, primary cells, and tissue samples. It also works well for immunoprecipitation, flow cytometry (1:100), and immunofluorescence (1:100). Reviewers highlight excellent signal intensity, good value for price, and consistent results across multiple cell types including adipocytes, mESCs, cancer cell lines, and primary macrophages. No negative feedback was noted.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Elizabeth (Verified Customer) (03-19-2026) | The antibody is a good value for the price we paid.
|
Lei (Verified Customer) (02-12-2026) | The antibody works well in WB
|
Sai Sindhura (Verified Customer) (12-22-2025) | This antibody is working very good
|
Rajkumar (Verified Customer) (04-18-2025) | I used this antibody for HRP-based detection and it worked very well at the suggested dilution. The signal was strong. Highly recommend for similar applications.
|
Mi (Verified Customer) (02-21-2023) | Works great in human adipocytes.
|
Ning (Verified Customer) (01-28-2023) | Excellent antibody to probe lamin B1.
 |
Tsimafei (Verified Customer) (12-04-2022) | 20µg of total protein were loaded. Incubation for 2h at room temperature. Excellent antibody
 |
Alejandro (Verified Customer) (08-07-2022) | Works fine for flow cytometry
|
Iram (Verified Customer) (09-04-2020) | Very sharp bands for nuclear protein
|
Chun (Verified Customer) (12-05-2019) | Excellent antibody
|
Marco (Verified Customer) (09-02-2019) | good staining in conjunction with Alexa Fluor Plus 488 secondary
|
