MAD2L2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• MAD2L2 Polyclonal antibody (12683-1-AP)

• Featured Product
• KD/KO Validated

MAD2L2 Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 12683-1-AP Copied!

Publications (21)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, IP, ELISA

Synonyms

hREV7, MAD2 like protein 2, MAD2B, MAD2-like protein 2, Mitotic arrest deficient 2-like protein 2

• 

  WB analysis of human brain using 12683-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 12683-1-AP (MAD2L2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HEK-293 using 12683-1-AP

  WB result of MAD2L2 antibody (12683-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-MAD2L2 transfected HEK-293 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse brain using 12683-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 12683-1-AP (MAD2L2 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 12683-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 12683-1-AP (MAD2L2 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HEK-293 using 12683-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 12683-1-AP (MAD2L2 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of K-562 using 12683-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 12683-1-AP (MAD2L2 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of fetal human brain using 12683-1-AP

  fetal human brain tissue were subjected to SDS PAGE followed by western blot with 12683-1-AP (MAD2L2 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of A375 using 12683-1-AP

  A375 cells were subjected to SDS PAGE followed by western blot with 12683-1-AP (MAD2L2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human kidney using 12683-1-AP

  human kidney tissue were subjected to SDS PAGE followed by western blot with 12683-1-AP (MAD2L2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human colon using 12683-1-AP

  human colon tissue were subjected to SDS PAGE followed by western blot with 12683-1-AP (MAD2L2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of mouse brain using 12683-1-AP

  IP result of anti-MAD2L2 (IP:12683-1-AP, 3ug; Detection:12683-1-AP 1:500) with mouse brain tissue lysate 3600ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human ovary tumor using 12683-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 12683-1-AP (MAD2L2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human ovary tumor using 12683-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 12683-1-AP (MAD2L2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lymphoma using 12683-1-AP

  Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 12683-1-AP (MAD2L2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lymphoma using 12683-1-AP

  Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 12683-1-AP (MAD2L2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for MAD2L2 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: human brain tissue, A375 cells, human kidney tissue, human colon tissue, mouse brain tissue, HeLa cells, HEK-293 cells, K-562 cells, fetal human brain tissue
• Positive IP detected in: mouse brain tissue
• Positive IHC detected in: human ovary tumor tissue, human lymphoma tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2400
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

12683-1-AP targets MAD2L2 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3373

  Product name: Recombinant human MAD2L2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 2-211 aa of BC015244

  Sequence: TTLTRQDLNFGQVVADVLCEFLEVAVHLILYVREVYPVGIFQKRKKYNVPVQMSCHPELNQYIQDTLHCVKPLLEKNDVEKVVVVILDKEHRPVEKFVFEITQPPLLSISSDSLLSHVEQLLRAFILKISVCDAVLDHNPPGCTFTVLVHTREAATRNMEKIQVIKDFPWILADEQDVHMHDPRLIPLKTMTSDILKMQLYVEERAHKGS

• Full Name: MAD2 mitotic arrest deficient-like 2 (yeast)
• Calculated Molecular Weight: 211 aa, 24 kDa
• Observed Molecular Weight: 24 kDa
• GenBank Accession Number: BC015244
• Gene Symbol: MAD2L2
• Gene ID (NCBI): 10459
• RRID: AB_2139530
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UI95
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MAD family, together with BUB and Mps1,Cdc20k, play roles in the mitotic spindle checkpoint. MAD2L2 is one of the MAD family. It can mediate the second polymerase switching in translation DNA synthesis by mediating the interaction between the error-prone DNA polymerase zeta catalytic subunit REV3L and the inserter polymerase REV1. Through regulation of the JNK-mediate phosphorylation and activation of the transcriptional activator ELK1, MAD2L2 involves in cellular response to DNA damage. Also it has role in the progression of cell cycle and peithelial-mesenchymal transdifferentiation.

Publications

What published studies show

The MAD2L2 (MAD2B/REV7) Polyclonal antibody, catalog number 12683-1-AP, has 21 citations. These appear in journals including Nature Communications, Nucleic Acids Research, Cell Reports, Cell Death & Disease, International Journal of Biological Sciences, Journal of Cell Biology, Journal of Medicinal Chemistry, Molecules, Cancer Science, Molecular Oncology, iScience, FASEB Journal, Biochemical and Biophysical Research Communications, bioRxiv, and Cureus. Research fields span DNA repair, DNA damage response, cell cycle regulation, and cancer biology.

Automatically generated from the 21 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nat Commun; The RING finger E3 ligase RNF25 protects DNA replication forks independently of its canonical roles in ubiquitin signaling; Authors - Lilly F Chiou
human	WB	Nat Commun; MAD2L2 dimerization and TRIP13 control shieldin activity in DNA repair.; Authors - Inge de Krijger ; KO Validated
mouse	WB	Nat Commun; SHLD1 is dispensable for 53BP1-dependent V(D)J recombination but critical for productive class switch recombination.; Authors - Estelle Vincendeau
human	WB	Nucleic Acids Res; REV1 and polymerase ζ facilitate homologous recombination repair.; Authors - Sharma Shilpy S ; KD Validated
human	WB,IP	Nucleic Acids Res; REV7 associates with ATRIP and inhibits ATR kinase activity.; Authors - Megan Biller ; KO Validated
human	WB	Nucleic Acids Res; REV7 is essential for DNA damage tolerance via two REV3L binding sites in mammalian DNA polymerase ζ; Authors - Junya Tomida ; KD Validated