MCL1 Polyclonal antibody

• 

  WB analysis using 16225-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 16225-1-AP (MCL1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 16225-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 16225-1-AP (MCL1 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 16225-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 16225-1-AP (MCL1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of A431 using 16225-1-AP

  A431 cells were subjected to SDS PAGE followed by western blot with 16225-1-AP (MCL1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse spleen using 16225-1-AP

  mouse spleen tissue were subjected to SDS PAGE followed by western blot with 16225-1-AP (MCL1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of K-562 using 16225-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 16225-1-AP (MCL1 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Raji using 16225-1-AP

  Raji cells were subjected to SDS PAGE followed by western blot with 16225-1-AP (MCL1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HL-60 using 16225-1-AP

  HL-60 cells were subjected to SDS PAGE followed by western blot with 16225-1-AP (MCL1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human liver using 16225-1-AP

  human liver tissue were subjected to SDS PAGE followed by western blot with 16225-1-AP (MCL1 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human brain using 16225-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 16225-1-AP (MCL1 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

• 

  IP experiment of Raji using 16225-1-AP

  IP result of anti-MCL1 (IP:16225-1-AP, 3ug; Detection:16225-1-AP 1:1000) with Raji cells lysate 800ug.

• 

  IHC staining of human ovary cancer using 16225-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 16225-1-AP (MCL1 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human ovary cancer using 16225-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 16225-1-AP (MCL1 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of MCF-7 using 16225-1-AP

  Immunofluorescent analysis of (4% PFA) fixed MCF-7 cells using MCL1 antibody (16225-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

• 

  FC experiment of Ramos using 16225-1-AP

  1X10^6 Ramos cells were intracellularly stained with 0.5 ug Anti-Human MCL1 (16225-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) at dilution 1:1000 (red), or 0.5 ug Control Antibody. Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011).

• Featured Product
• KD/KO Validated

MCL1 Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Cat No. 16225-1-AP

Publications(153)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA

Synonyms

Bcl2-L-3, Bcl-2-like protein 3, Bcl-2-related protein EAT/mcl1, EAT, Induced myeloid leukemia cell differentiation protein Mcl-1

---

Tested Applications

• Positive WB detected in: Jurkat cells, mouse spleen tissue, Raji cells, HL-60 cells, A431 cells, human liver tissue, HEK-293T cells, human brain tissue, K-562 cells, MCF-7 cells, HeLa cells
• Positive IP detected in: Raji cells
• Positive IHC detected in: human ovary cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: MCF-7 cells
• Positive FC (Intra) detected in: Ramos cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.50 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 11 publications below
• WB: See 135 publications below
• IHC: See 16 publications below
• IF: See 7 publications below
• IP: See 7 publications below
• CoIP: See 1 publications below

Product Information

16225-1-AP targets MCL1 in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10397

  Product name: Recombinant human MCL1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-327 aa of BC107735

  Sequence: MFGLKRNAVIGLNLYCGGAGLGAGSGGATRPGGRLLATEKEASARREIGGGEAGAVIGGSAGASPPSTLTPDSRRVARPPPIGAEVPDVTATPARLLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFHVEDLEGG

• Full Name: myeloid cell leukemia sequence 1 (BCL2-related)
• Calculated Molecular Weight: 350 aa, 37 kDa
• Observed Molecular Weight: 35-40 kDa
• GenBank Accession Number: BC107735
• Gene Symbol: MCL1
• Gene ID (NCBI): 4170
• RRID: AB_2143977
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q07820
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MCL-1 is an anti-apoptotic member of the Bcl-2 family originally isolated from the ML-1 human myeloid leukemia cell line. Similar to BCL2 and BCL2L1, MCL1 can interact with BAX and/or BAK1 to inhibit mitochondria-mediated apoptosis. Mcl-1 is critical for the proliferation and survival of myeloma cells in vitro, and overexpression of Mcl-1 protein in myeloma cells is associated with relapse and short event-free survival in multiple myeloma patients. Recent studies show that MCL-1 is upregulated in numerous haematological and solid tumour malignancies. Therefore, MCL-1 has been suggested as a potential new therapeutic target. MCL-1 can be alternatively spliced into a long form (MCL-1L, 40 kDa) or a short form (MCL-1S, 30 kDa). (PMID: 15467463, PMID: 15147382)

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Mol Cell; The mitochondrial DNAJC co-chaperone TCAIM reduces α-ketoglutarate dehydrogenase protein levels to regulate metabolism; Authors - Wang Jiahui
mouse	IHC	Nat Commun; MCL-1 gains occur with high frequency in lung adenocarcinoma and can be targeted therapeutically.; Authors - Enkhtsetseg Munkhbaatar
human	WB	Nat Commun; Small-molecule suppression of calpastatin degradation reduces neuropathology in models of Huntington's disease.; Authors - Di Hu
mouse	WB	Nat Commun; IFN-β is a macrophage-derived effector cytokine facilitating the resolution of bacterial inflammation.; Authors - Senthil Kumaran Satyanarayanan
human	WB	EBioMedicine; The LIV-1-GRPEL1 axis adjusts cell fate during anti-mitotic agent-damaged mitosis.; Authors - Pingbo Chen
human	WB,IP	Nat Commun; USP9X regulates centrosome duplication and promotes breast carcinogenesis.; Authors - Xin Li

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Eya (Verified Customer) (07-06-2021)

the bands appear very clear

• Applications: Western Blot
• Primary Antibody Dilution: 1/1000
• Cell Tissue Type: shTHP1