MED20 Polyclonal antibody

• 

  WB analysis of K-562 using 17598-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 17598-1-AP (MED20 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 17598-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 17598-1-AP (MED20 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• Featured Product
• KD/KO Validated

MED20 Polyclonal Antibody for WB, ELISA

Cat No. 17598-1-AP

Publications(3)

Reviews (2)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, ELISA

Synonyms

hTRFP, MED 20, Mediator of RNA polymerase II transcription subunit 20, TRF-proximal protein homolog

---

Tested Applications

• Positive WB detected in: K-562 cells, HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 3 publications below

Product Information

17598-1-AP targets MED20 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11598

  Product name: Recombinant human MED20 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-212 aa of BC040950

  Sequence: MGVTCVSQMPVAEGKSVQQTVELLTRKLEMLGAEKQGTFCVDCETYHTAASTLGSQGQTGKLMYVMHNSEYPLSCFALFENGPCLIADTNFDVLMVKLKGFFQSAKASKIETRGTRYQYCDFLVKVGTVTMGPSARGISVEVEYGPCVVASDCWSLLLEFLQSFLGSHTPGAPAVFGNRHDAVYGPADTMVQYMELFNKIRKQQQVPVAGIR

• Full Name: mediator complex subunit 20
• Calculated Molecular Weight: 212 aa, 23 kDa
• Observed Molecular Weight: 28 kDa
• GenBank Accession Number: BC040950
• Gene Symbol: MED20
• Gene ID (NCBI): 9477
• RRID: AB_2142162
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H944
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MED20(Mediator of RNA polymerase II transcription subunit 20) is also named as TRFP and belongs to the Mediator complex subunit 20 family. The deduced 209-amino acid protein shares 44% amino identity with Drosophila Trfp. TRFP had an apparent molecular mass of 28 kD by SDS-PAGE. It is identified TRFP as a component of an RNA polymerase II-SRB complex. The TRFP-containing complex could substitute for core RNA polymerase II in driving basal transcription from a minimal promoter.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Nat Commun; Surplus fatty acid synthesis increases oxidative stress in adipocytes and lnduces lipodystrophy; Authors - Li Weng
human	WB	J Virol; Adenovirus L-E1A activates transcription through mediator complex-dependent recruitment of the super elongation complex.; Authors - Vijayalingam S S
mouse	WB	Cell Rep; The Mediator subunit MED20 organizes the early adipogenic complex to promote development of adipose tissues and diet-induced obesity.; Authors - Wen-Shuai Tang ; KO Validated

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Raphaël (Verified Customer) (11-12-2024)

I work on MED20 variants and your antibody againt MED20 is the best. I tried 5 differents antibodies and yours is the only one really working

• Applications: Western Blot
• Primary Antibody Dilution: 1/1000
• Cell Tissue Type: fibroblastes

FH

siting (Verified Customer) (05-25-2021)

clear band

• Applications: Western Blot
• Primary Antibody Dilution: 1:500
• Cell Tissue Type: mouse embryo heart