MEK5 Polyclonal antibody, PBS Only

• 

  WB analysis of HEK-293T using 15758-1-AP (same clone as 15758-1-PBS)

  HEK-293T cells were subjected to SDS PAGE followed by western blot with 15758-1-AP (MEK5 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15758-1-PBS in a different storage buffer formulation.

• 

  WB analysis of A431 using 15758-1-AP (same clone as 15758-1-PBS)

  A431 cells were subjected to SDS PAGE followed by western blot with 15758-1-AP (MEK5 antibody at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15758-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 15758-1-AP (same clone as 15758-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 15758-1-AP (MEK5 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15758-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human heart using 15758-1-AP (same clone as 15758-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human heart using 15758-1-AP (MEK5 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 15758-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human heart using 15758-1-AP (same clone as 15758-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human heart using 15758-1-AP (MEK5 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 15758-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 15758-1-AP (same clone as 15758-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis using 15758-1-AP (MEK5 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 15758-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 15758-1-AP (same clone as 15758-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis using 15758-1-AP (MEK5 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 15758-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 15758-1-AP (same clone as 15758-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis using 15758-1-AP (MEK5 antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 15758-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 15758-1-AP (same clone as 15758-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis using 15758-1-AP (MEK5 antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 15758-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 15758-1-AP (same clone as 15758-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using MEK5 antibody (15758-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 15758-1-PBS in a different storage buffer formulation.

MEK5 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 15758-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

15758-1-PBS targets MEK5 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8351

  Product name: Recombinant human MAP2K5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 96-448 aa of BC008838

  Sequence: GQLIEPLQIFPRACKPPGERNIHGLKVNTRAGPSQHSSPAVSDSLPSNSLKKSSAELKKILANGQMNEQDIRYRDTLGHGNGGTVYKAYHVPSGKILAVKVILLDITLELQKQIMSELEILYKCDSSYIIGFYGAFFVENRISICTEFMDGGSLDVYRKMPEHVLGRIAVAVVKGLTYLWSLKILHRDVKPSNMLVNTRGQVKLCDFGVSTQLVNSIAKTYVGTNAYMAPERISGEQYGIHSDVWSLGISFMELALGRFPYPQIQKNQGSLMPLQLLQCIVDEDSPVLPVGEFSEPFVHFITQCMRKQPKERPAPEELMGHPFIVQFNDGNAAVVSMWVCRALEERRSQQGPP

• Full Name: mitogen-activated protein kinase kinase 5
• Calculated Molecular Weight: 448 aa, 50 kDa
• Observed Molecular Weight: 55 kDa
• GenBank Accession Number: BC008838
• Gene Symbol: MEK5
• Gene ID (NCBI): 5607
• RRID: AB_2141275
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q13163
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.