Recombinant human MICAL3 protein
Source
e coli.-derived, PET30a
Tag
6*His
Format
Liquid
Cat no : Ag20962
Synonyms
MICAL3, KIAA0819, KIAA1364
Validation Data Gallery View All
Product Information
| Peptide Sequence |
LTQFYEMFKDSLPSSDTLDLNAEEKAVLIASTRSPISFLSKLGQTISRKRSPKDKKEKDLDGAGKRRKTSQSEEEEAPRGHRGERPTLVSTLTDRRMDVAV
(616-716 aa encoded by BC157876) |
| Activity | Not tested. |
| Endotoxin Level | Please contact the lab for more information. |
