Tested Applications
| Positive WB detected in | A549 cells, HL-60 cells, U-937 cells, Y79 cells, U-87 MG cells, HEK-293T cells, HUVEC cells, J774A.1 cells, Neuro-2a cells, mouse spleen tissue, rat spleen tissue, Jurkat cells |
| Positive IP detected in | mouse spleen tissue |
| Positive IF/ICC detected in | U-251 cells |
| Positive FC (Intra) detected in | THP-1 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
20415-1-AP targets MIF in WB, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag14058 Product name: Recombinant human MIF protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 51-115 aa of BC000447 Sequence: GGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA Predict reactive species |
| Full Name | macrophage migration inhibitory factor (glycosylation-inhibiting factor) |
| Calculated Molecular Weight | 115 aa, 12 kDa |
| Observed Molecular Weight | 12 kDa |
| GenBank Accession Number | BC000447 |
| Gene Symbol | MIF |
| Gene ID (NCBI) | 4282 |
| RRID | AB_10694820 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P14174 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
MIF is a pleiotropic cytokine that contributes to the pathogenesis of many autoimmune diseases through its upstream immunoregulatory function and its polymorphic genetic locus. MIF is a highly conserved protein of 12.5 kDa, with evolutionarily ancient homologues in plants, protozoans, nematodes, and invertebrates.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for MIF antibody 20415-1-AP | Download protocol |
| IF protocol for MIF antibody 20415-1-AP | Download protocol |
| IP protocol for MIF antibody 20415-1-AP | Download protocol |
| WB protocol for MIF antibody 20415-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
Anti-MIF (Macrophage Migration Inhibitory Factor), catalog number 20415-1-AP, has 43 citations published in journals including Science, Nature Communications, Nature Cardiovascular Research, Advanced Science, Cancer Letters, Cell Death Discovery, NPJ Precision Oncology, and Frontiers in Immunology. Research fields span oncology (pancreatic, gastric, oral, head-and-neck cancers), immunology, inflammation, neurology, cardiology, nephrology, bone/joint degeneration, ophthalmology, and pharmacology. Applications include WB and IF.
| Species | Application | Title |
|---|---|---|
Science Multiscale photocatalytic proximity labeling reveals cell surface neighbors on and between cells | ||
Drug Resist Updat Targeting keratin 6 A overcomes gemcitabine resistance by restoring equilibrative nucleoside transporter 1 and TAM-mediated metabolic compensation in pancreatic cancer. | ||
Nat Commun Single-cell multi-omics analysis of human testicular germ cell tumor reveals its molecular features and microenvironment | ||
Biomark Res Single-cell and spatial transcriptome analysis reveals the potential therapeutic targets for testicular sex cord-stromal cell tumor. | ||
Adv Sci (Weinh) Elevated TRIM25 Impairs Poly (ADP-ribose) Metabolism via PARG Degradation and Mediates Compression-Induced Intervertebral Disc Degeneration. | ||
Reviews
What customers say
Customers rate this antibody highly across multiple applications. For Western blot, users report clear bands at the expected molecular weight in cell lysates (293T, HCT116, PC3) at 1:1000 dilution, with one noting reliable performance even at low protein concentrations. Immunofluorescence on ovarian tissue at 1:200 with TE buffer antigen retrieval yielded strong results. Immunohistochemistry/IF on zebrafish brain at 1:100 showed good co-localization with microglia markers. Overall, reviewers describe it as a dependable, specific antibody with consistent performance.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Tianyi (Verified Customer) (01-12-2024) | Antigen retrieval in TE buffer, incubated with AF594 for 2 h at RT
 |
sarah (Verified Customer) (10-27-2023) | antibody worked great for WB
|
Sarah (Verified Customer) (01-24-2023) | This antibody worked well despite low protein concentration.
|
Emma (Verified Customer) (03-15-2022) | Nice antibody have used overnight @ 1:1000 on cell lysates and conditioned media. Produces a band at the correct size.
|
Ryan (Verified Customer) (02-27-2019) | Tissue was fixed in PFA with no additional antigen retrieval. Co-localisation with microglia based on known markers (not shown).
 |
