• Featured Product
  • KD/KO Validated

CoraLite® Plus 555-conjugated MIF Polyclonal antibody

MIF Polyclonal Antibody for FC (Intra)
Cat No. CL555-20415

Host / Isotype

Rabbit / IgG

Reactivity

human, rat, mouse

Applications

FC (Intra)

GIF, GLIF, L dopachrome isomerase, L dopachrome tautomerase, MIF, MMIF, Phenylpyruvate tautomerase

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 555
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inA549 cells
Positive FC detected inA549 cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension
Flow Cytometry (FC)FC : 0.20 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL555-20415 targets MIF in FC (Intra) applications and shows reactivity with human, rat, mouse samples.

Tested Reactivity human, rat, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag14058

Product name: Recombinant human MIF protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 51-115 aa of BC000447

Sequence: GGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA

Predict reactive species
Full Name macrophage migration inhibitory factor (glycosylation-inhibiting factor)
Calculated Molecular Weight 115 aa, 12 kDa
Observed Molecular Weight 12 kDa
GenBank Accession NumberBC000447
Gene Symbol MIF
Gene ID (NCBI) 4282
RRIDAB_3084532
Conjugate CoraLite® Plus 555 Fluorescent Dye
Excitation/Emission Maxima Wavelengths554 nm / 570 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP14174
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

MIF is a pleiotropic cytokine that contributes to the pathogenesis of many autoimmune diseases through its upstream immunoregulatory function and its polymorphic genetic locus. MIF is a highly conserved protein of 12.5 kDa, with evolutionarily ancient homologues in plants, protozoans, nematodes, and invertebrates.

Protocols

Product Specific Protocols
FC protocol for CL Plus 555 MIF antibody CL555-20415Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...