Tested Applications
| Positive FC (Intra) detected in | A549 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
CL555-20415 targets MIF in FC (Intra) applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag14058 Product name: Recombinant human MIF protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 51-115 aa of BC000447 Sequence: GGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA Predict reactive species |
| Full Name | macrophage migration inhibitory factor (glycosylation-inhibiting factor) |
| Calculated Molecular Weight | 115 aa, 12 kDa |
| Observed Molecular Weight | 12 kDa |
| GenBank Accession Number | BC000447 |
| Gene Symbol | MIF |
| Gene ID (NCBI) | 4282 |
| RRID | AB_3084532 |
| Conjugate | CoraLite® Plus 555 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 554 nm / 570 nm |
| Excitation Laser | Green Laser (532 nm), Yellow-Green Laser (561 nm) |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P14174 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
MIF is a pleiotropic cytokine that contributes to the pathogenesis of many autoimmune diseases through its upstream immunoregulatory function and its polymorphic genetic locus. MIF is a highly conserved protein of 12.5 kDa, with evolutionarily ancient homologues in plants, protozoans, nematodes, and invertebrates.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for CL Plus 555 MIF antibody CL555-20415 | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

