Recombinant human MME,CD10 protein
Source
e coli.-derived, PET30a
Tag
6*His
Format
Liquid
Cat no : Ag20963
Synonyms
MME, Neprilysin, Neprilysin/CD10, Atriopeptidase, CALLA
Validation Data Gallery View All
Product Information
| Peptide Sequence |
YVEAAFAGESKHVVEDLIAQIREVFIQTLDDLTWMDAETKKRAEEKALAIKERIGYPDDIVSNDNKLNNEYLELNYKEDEYFENIIQNLKFSQSKQLKKLR
(427-527 aa encoded by BC101658) |
| Activity | Not tested. |
| Endotoxin Level | Please contact the lab for more information. |
