Tested Applications
| Positive WB detected in | A549 cells, human colon tissue |
| Positive IF/ICC detected in | HepG2 cells, COLO 320 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
14552-1-AP targets MMP14 / MT1-MMP in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag5965 Product name: Recombinant human MMP14 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-350 aa of BC064803 Sequence: MSPAPRPSRCLLLPLLTLGTALASLGSAQSSSFSPEAWLQQYGYLPPGDLRTHTQRSPQSLSAAIAAMQKFYGLQVTGKADADTMKAMRRPRCGVPDKFGAEIKANVRRKRYAIQGLKWQHNEITFCIQNYTPKVGEYATYEAIRKAFRVWESATPLRFREVPYAYIREGHEKQADIMIFFAEGFHGDSTPFDGEGGFLAHAYFPGPNIGGDTHFDSAEPWTVRNEDLNGNDIFLVAVHELGHALGLEHSSDPSAIMAPFYQWMDTENFVLPDDDRRGIQQLYGGESGFPTKMPPQPRTTSRPSVPDKPKNPTYGPNICDGNFDTVAMLRGEMFVFKERWFWRVRNNQVM Predict reactive species |
| Full Name | matrix metallopeptidase 14 (membrane-inserted) |
| Calculated Molecular Weight | 66 kDa |
| Observed Molecular Weight | 66 kDa, 45-50 kDa |
| GenBank Accession Number | BC064803 |
| Gene Symbol | MMP14 |
| Gene ID (NCBI) | 4323 |
| RRID | AB_2250751 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P50281 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
MMP14, also named as MT1-MMP, is a key matrix metalloproteinase (MMP) family member which plays a crucial role in tumor growth, invasion and metastasis. MT1-MMP is a cell membrane-bound proteinase, and it enhances degradation of collagen IV, a major component of the basement membrane, by forming a complex with tissue inhibitor of metalloproteinase-2 (TIMP-2) to activate pro-MMP-2. MT1-MMP can influence venous invasion, intrahepatic metastasis , and patient outcome in hepatocellular carcinoma (HCC). MT1-MMP was reported to be present in centromere and could lead to chromosome instability in MDCK cells, indicating that MT1-MMP may have more novel functions in the intracellular compartments. In western blotting, pro-MMP14 (65 kDa) and MMP14 (51 kDa) bands showed with the truncated MMP14 (45, 42, 35, 20 kDa) forms (PMID:12097451).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for MMP14 / MT1-MMP antibody 14552-1-AP | Download protocol |
| WB protocol for MMP14 / MT1-MMP antibody 14552-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The MMP14/MT1-MMP polyclonal antibody (Cat# 14552-1-AP) has 45 citations across journals including Gut, Advanced Science, Cancer Letters, Molecular Therapy, Journal of Neuroinflammation, International Journal of Molecular Sciences, Cancers, and BMC Cancer. Research fields span oncology (hepatocellular carcinoma, glioblastoma, breast cancer, melanoma, osteosarcoma), vasculogenic mimicry, epithelial-mesenchymal transition, renal fibrosis, diabetic nephropathy, neuroinflammation, and preeclampsia. Cited applications include WB, IHC, and IF in human, mouse, and rat samples.
| Species | Application | Title |
|---|---|---|
Gut CD48 is a novel immune checkpoint on tumour-associated macrophages in hepatocellular carcinoma | ||
Adv Sci (Weinh) Neoadjuvant Chemotherapy With Cisplatin Up-Regulates GSDMD to Enhance Oral Squamous Cell Carcinoma Metastasis Through MMP14-Mediated EMT Activation | ||
J Control Release Dentin tubules as a long-term sustained release carrier to accelerate bone repair by loading FTY720 | ||
Cell Mol Biol Lett The promoting roles of GLP1R and GIPR in stemness maintenance and multiple lineage-specific differentiation of PDLSCs. | ||
Cancer Lett Long non-coding RNA MALAT1 promotes gastric cancer tumorigenicity and metastasis by regulating vasculogenic mimicry and angiogenesis. | ||
Int J Biol Sci Decrease of circARID1A retards glioblastoma invasion by modulating miR-370-3p/ TGFBR2 pathway |
Reviews
What customers say
The single review rates this antibody 5 stars for Western Blot on glomerular endothelial cells at a 1:1000 dilution. The reviewer reports clear bands at the expected molecular weight, along with additional higher bands corresponding to multimeric forms of MMP14. Incubation times were 1 hour at room temperature for both primary and secondary antibodies. Overall, the reviewer expressed satisfaction with the product's performance.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Monica (Verified Customer) (11-14-2025) | Good antibody for MMP14 for WB. Western blot imaged after 1 hour incubation at RT for primary and 1 hr for secondary. Gives bands at expected molecular weight with some higher ones for multimeric forms of the protein. Overall pleased with this product.
 |
