MMP14 / MT1-MMP Polyclonal antibody

MMP14 / MT1-MMP Polyclonal Antibody for WB, IF/ICC, ELISA
Cat No. 14552-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

MMP14, Membrane-type-1 matrix metalloproteinase, Membrane-type matrix metalloproteinase 1, Matrix metalloproteinase-14, Matrix metalloproteinase 14

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA549 cells, human colon tissue
Positive IF/ICC detected inHepG2 cells, COLO 320 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

14552-1-AP targets MMP14 / MT1-MMP in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag5965

Product name: Recombinant human MMP14 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-350 aa of BC064803

Sequence: MSPAPRPSRCLLLPLLTLGTALASLGSAQSSSFSPEAWLQQYGYLPPGDLRTHTQRSPQSLSAAIAAMQKFYGLQVTGKADADTMKAMRRPRCGVPDKFGAEIKANVRRKRYAIQGLKWQHNEITFCIQNYTPKVGEYATYEAIRKAFRVWESATPLRFREVPYAYIREGHEKQADIMIFFAEGFHGDSTPFDGEGGFLAHAYFPGPNIGGDTHFDSAEPWTVRNEDLNGNDIFLVAVHELGHALGLEHSSDPSAIMAPFYQWMDTENFVLPDDDRRGIQQLYGGESGFPTKMPPQPRTTSRPSVPDKPKNPTYGPNICDGNFDTVAMLRGEMFVFKERWFWRVRNNQVM

Predict reactive species
Full Name matrix metallopeptidase 14 (membrane-inserted)
Calculated Molecular Weight 66 kDa
Observed Molecular Weight 66 kDa, 45-50 kDa
GenBank Accession NumberBC064803
Gene Symbol MMP14
Gene ID (NCBI) 4323
RRIDAB_2250751
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP50281
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MMP14, also named as MT1-MMP, is a key matrix metalloproteinase (MMP) family member which plays a crucial role in tumor growth, invasion and metastasis. MT1-MMP is a cell membrane-bound proteinase, and it enhances degradation of collagen IV, a major component of the basement membrane, by forming a complex with tissue inhibitor of metalloproteinase-2 (TIMP-2) to activate pro-MMP-2. MT1-MMP can influence venous invasion, intrahepatic metastasis , and patient outcome in hepatocellular carcinoma (HCC). MT1-MMP was reported to be present in centromere and could lead to chromosome instability in MDCK cells, indicating that MT1-MMP may have more novel functions in the intracellular compartments. In western blotting, pro-MMP14 (65 kDa) and MMP14 (51 kDa) bands showed with the truncated MMP14 (45, 42, 35, 20 kDa) forms (PMID:12097451).

Protocols

Product Specific Protocols
IF protocol for MMP14 / MT1-MMP antibody 14552-1-APDownload protocol
WB protocol for MMP14 / MT1-MMP antibody 14552-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
human,ratWB,IF

J Neuroinflammation

SPOCK2 modulates neuropathic pain by interacting with MT1-MMP to regulate astrocytic MMP-2 activation in rats with chronic constriction injury

Authors - Chenglong Wang
mouseWB

Mol Ther

METTL3-mediated m6A modification of TIMP2 mRNA promotes podocyte injury in diabetic nephropathy.

Authors - Ling Jiang
humanWB

Int J Mol Sci

LncRNA H19-Derived miR-675-5p Accelerates the Invasion of Extravillous Trophoblast Cells by Inhibiting GATA2 and Subsequently Activating Matrix Metalloproteinases.

Authors - Manabu Ogoyama
humanWB

Int J Mol Sci

PLOD2 Is a Prognostic Marker in Glioblastoma That Modulates the Immune Microenvironment and Tumor Progression.

Authors - Nina Kreße
humanWB

Cancers (Basel)

WISP2/CCN5 Suppresses Vasculogenic Mimicry through Inhibition of YAP/TAZ Signaling in Breast Cancer Cells.

Authors - Nathalie Ferrand
humanWB

Cancer Lett

Long non-coding RNA MALAT1 promotes gastric cancer tumorigenicity and metastasis by regulating vasculogenic mimicry and angiogenesis.

Authors - Yue Li

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Monica (Verified Customer) (11-14-2025)

Good antibody for MMP14 for WB. Western blot imaged after 1 hour incubation at RT for primary and 1 hr for secondary. Gives bands at expected molecular weight with some higher ones for multimeric forms of the protein. Overall pleased with this product.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Glomerular endothelail cells
MMP14 / MT1-MMP Antibody Western Blot validation (1:1000 dilution) in Glomerular endothelail cells (Cat no:14552-1-AP)
Loading...
||
New chat Able
正在加载,请稍候...