CoraLite® Plus 488-conjugated MMP14 / MT1-MMP Polyclonal antibody

• 

  IF Staining of HepG2 using CL488-14552

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using CoraLite® Plus 488 MMP14 / MT1-MMP antibody (CL488-14552) at dilution of 1:200.

MMP14 / MT1-MMP Polyclonal Antibody for IF/ICC

Cat No. CL488-14552

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC

Synonyms

Matrix metalloproteinase 14, MMP 14, MMP X1, MMP14, MT MMP 1, MT1 MMP, MT1MMP, MTMMP1

---

Tested Applications

• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-14552 targets MMP14 / MT1-MMP in IF/ICC applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5965

  Product name: Recombinant human MMP14 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-350 aa of BC064803

  Sequence: MSPAPRPSRCLLLPLLTLGTALASLGSAQSSSFSPEAWLQQYGYLPPGDLRTHTQRSPQSLSAAIAAMQKFYGLQVTGKADADTMKAMRRPRCGVPDKFGAEIKANVRRKRYAIQGLKWQHNEITFCIQNYTPKVGEYATYEAIRKAFRVWESATPLRFREVPYAYIREGHEKQADIMIFFAEGFHGDSTPFDGEGGFLAHAYFPGPNIGGDTHFDSAEPWTVRNEDLNGNDIFLVAVHELGHALGLEHSSDPSAIMAPFYQWMDTENFVLPDDDRRGIQQLYGGESGFPTKMPPQPRTTSRPSVPDKPKNPTYGPNICDGNFDTVAMLRGEMFVFKERWFWRVRNNQVM

• Full Name: matrix metallopeptidase 14 (membrane-inserted)
• Calculated Molecular Weight: 66 kDa
• Observed Molecular Weight: 66 kDa, 45-50 kDa
• GenBank Accession Number: BC064803
• Gene Symbol: MMP14
• Gene ID (NCBI): 4323
• RRID: AB_3083959
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P50281
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

MMP14, also named as MT1-MMP, is a key matrix metalloproteinase (MMP) family member which plays a crucial role in tumor growth, invasion and metastasis. MT1-MMP is a cell membrane-bound proteinase, and it enhances degradation of collagen IV, a major component of the basement membrane, by forming a complex with tissue inhibitor of metalloproteinase-2 (TIMP-2) to activate pro-MMP-2. MT1-MMP can influence venous invasion, intrahepatic metastasis , and patient outcome in hepatocellular carcinoma (HCC). MT1-MMP was reported to be present in centromere and could lead to chromosome instability in MDCK cells, indicating that MT1-MMP may have more novel functions in the intracellular compartments. In western blotting, pro-MMP14 (65 kDa) and MMP14 (51 kDa) bands showed with the truncated MMP14 (45, 42, 35, 20 kDa) forms (PMID:12097451).