CoraLite® Plus 488-conjugated MMP14 / MT1-MMP Polyclonal antibody

MMP14 / MT1-MMP Polyclonal Antibody for IF/ICC
Cat No. CL488-14552

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC

Matrix metalloproteinase 14, MMP 14, MMP X1, MMP14, MT MMP 1, MT1 MMP, MT1MMP, MTMMP1

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-14552 targets MMP14 / MT1-MMP in IF/ICC applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag5965

Product name: Recombinant human MMP14 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-350 aa of BC064803

Sequence: MSPAPRPSRCLLLPLLTLGTALASLGSAQSSSFSPEAWLQQYGYLPPGDLRTHTQRSPQSLSAAIAAMQKFYGLQVTGKADADTMKAMRRPRCGVPDKFGAEIKANVRRKRYAIQGLKWQHNEITFCIQNYTPKVGEYATYEAIRKAFRVWESATPLRFREVPYAYIREGHEKQADIMIFFAEGFHGDSTPFDGEGGFLAHAYFPGPNIGGDTHFDSAEPWTVRNEDLNGNDIFLVAVHELGHALGLEHSSDPSAIMAPFYQWMDTENFVLPDDDRRGIQQLYGGESGFPTKMPPQPRTTSRPSVPDKPKNPTYGPNICDGNFDTVAMLRGEMFVFKERWFWRVRNNQVM

Predict reactive species
Full Name matrix metallopeptidase 14 (membrane-inserted)
Calculated Molecular Weight 66 kDa
Observed Molecular Weight 66 kDa, 45-50 kDa
GenBank Accession NumberBC064803
Gene Symbol MMP14
Gene ID (NCBI) 4323
RRIDAB_3083959
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP50281
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

MMP14, also named as MT1-MMP, is a key matrix metalloproteinase (MMP) family member which plays a crucial role in tumor growth, invasion and metastasis. MT1-MMP is a cell membrane-bound proteinase, and it enhances degradation of collagen IV, a major component of the basement membrane, by forming a complex with tissue inhibitor of metalloproteinase-2 (TIMP-2) to activate pro-MMP-2. MT1-MMP can influence venous invasion, intrahepatic metastasis , and patient outcome in hepatocellular carcinoma (HCC). MT1-MMP was reported to be present in centromere and could lead to chromosome instability in MDCK cells, indicating that MT1-MMP may have more novel functions in the intracellular compartments. In western blotting, pro-MMP14 (65 kDa) and MMP14 (51 kDa) bands showed with the truncated MMP14 (45, 42, 35, 20 kDa) forms (PMID:12097451).

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 MMP14 / MT1-MMP antibody CL488-14552Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...