MOSPD1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• MOSPD1 Polyclonal antibody (32307-1-AP)

• 

  WB analysis using 32307-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 32307-1-AP (MOSPD1 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse cerebellum using 32307-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 32307-1-AP (MOSPD1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

MOSPD1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 32307-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

Motile sperm domain-containing protein 1

---

Tested Applications

• Positive WB detected in: MDA-MB-231 cells, PC-3 cells
• Positive IHC detected in: mouse cerebellum tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunohistochemistry (IHC): IHC : 1:50-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

32307-1-AP targets MOSPD1 in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag37532

  Product name: Recombinant human MOSPD1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-213 aa of BC005700

  Sequence: MHQQKRQPELVEGNLPVFVFPTELIFYADDQSTHKQVLTLYNPYEFALKFKVLCTTPNKYVVVDAAGAVKPQCCVDIVIRHRDVRSCHYGVIDKFRLQVSEQSQRKALGRKEVVATLLPSAKEQQKEEEEKRLKEHLTESLFFEQSFQPENRAVSSGPSLLTVFLGVVCIAALMLPTLGDVESLVPLYLHLSVNQKLVAAYILGLITMAILRT

• Full Name: motile sperm domain containing 1
• Calculated Molecular Weight: 24 kDa
• Observed Molecular Weight: 25 kDa
• GenBank Accession Number: BC005700
• Gene Symbol: MOSPD1
• Gene ID (NCBI): 56180
• RRID: AB_3742574
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q9UJG1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MOSPD1, or Motile Sperm Domain-Containing Protein 1, is a protein that has been implicated in various biological processes. It is part of a family of proteins characterized by the presence of the major sperm protein domain and two transmembrane domains (PMID: 21792907). The protein is primarily located in the endoplasmic reticulum and Golgi apparatus, and it can also be found in the nucleus under certain conditions. MOSPD1 plays a significant role in the differentiation and proliferation of mesenchymal stem cells (MSCs). Studies have shown that MOSPD1-null embryonic stem cells exhibit impaired differentiation into various cell lineages, including osteoblasts and adipocytes, indicating its importance in MSC proliferation and differentiation (PMID: 26175344). Additionally, MOSPD1 is involved in the switch between mesenchymal and epithelial cells, suggesting its role in developmental regulation.