Tested Applications
Positive WB detected in | HL-60 cells, U-937 cells |
Positive IP detected in | HL-60 cells |
Positive IHC detected in | human colon cancer tissue, human liver tissue, human spleen tissue, rat spleen tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF-P detected in | human tonsillitis tissue, mouse ovary tissue |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:1000-1:6000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 50 publications below |
IHC | See 96 publications below |
IF | See 69 publications below |
ELISA | See 5 publications below |
Product Information
22225-1-AP targets MPO in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse, rat, bovine, hamster |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag17564 Product name: Recombinant human MPO protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 606-657 aa of BC130476 Sequence: CGLPQPETVGQLGTVLRNLKLARKLMEQYGTPNNIDIWMGGVSEPLKRKGRV Predict reactive species |
Full Name | myeloperoxidase |
Calculated Molecular Weight | 745 aa, 84 kDa |
Observed Molecular Weight | 59 kDa |
GenBank Accession Number | BC130476 |
Gene Symbol | MPO |
Gene ID (NCBI) | 4353 |
RRID | AB_2879037 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P05164 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
The MPO gene encodes myeloperoxidase, a lysosomal hemoprotein located in the azurophilic granules of polymorphonuclear (PMN) leukocytes and monocytes. In response to stimulation, MPO is activated into a transient intermediate with potent antimicrobial oxidizing abilities(PMID:17650507). The mRNA is translated into a single protein of 90 kDa, which displays enzymatic activity and undergoes proteolytic maturation into a heavy chain of 59 kDa and a light chain of 13.5 kDa; these subunits then dimerize into the mature tetramer and the mature MPO is a heterotetramer composed of two identical heavy chains and two identical light chains(PMID:12773517). Fragments with molecular masses of 43-47 kDa were formed by autocatalysis during warming in sample buffer (PMID:12960244). The 24-kDa material had a map identical to that of 13.5 kDa subunit and represents a dimer of the 13.5 kDa subunit (PMID:3008892). Defects in MPO are the cause of myeloperoxidase deficiency (MPOD). It has 3 isoforms produced by alternative splicing. This antibody is specific to MPO.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for MPO antibody 22225-1-AP | Download protocol |
IHC protocol for MPO antibody 22225-1-AP | Download protocol |
IF protocol for MPO antibody 22225-1-AP | Download protocol |
IP protocol for MPO antibody 22225-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Crit Care Recombinant ACE2 protein protects against acute lung injury induced by SARS-CoV-2 spike RBD protein. | ||
Blood C1Q labels a highly aggressive macrophage-like leukemia population indicating extramedullary infiltration and relapse | ||
Acta Pharm Sin B A new perspective of triptolide-associated hepatotoxicity: the relevance of NF- κ B and NF- κ B-mediated cellular FLICE-inhibitory protein. | ||
Acta Pharm Sin B A non-human primate derived anti-P-selectin glycoprotein ligand-1 antibody curtails acute pancreatitis by alleviating the inflammatory responses | ||
Sci Adv Astrocytic NDRG2-PPM1A interaction exacerbates blood-brain barrier disruption after subarachnoid hemorrhage | ||
Acta Biomater An electrospun scaffold functionalized with a ROS-scavenging hydrogel stimulates ocular wound healing |