MYO1A Polyclonal antibody

• 

  WB analysis of HepG2 using 17499-1-AP

  WB result of MYO1A antibody (17499-1-AP; 1:600; incubated at room temperature for 1.5 hours) with sh-Control and sh-MYO1A transfected HepG2 cells.

• 

  WB analysis of mouse brain using 17499-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 17499-1-AP (MYO1A antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 17499-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 17499-1-AP (MYO1A antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 17499-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 17499-1-AP (MYO1A antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

• 

  WB analysis of A431 using 17499-1-AP

  A431 cells were subjected to SDS PAGE followed by western blot with 17499-1-AP (MYO1A antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HeLa using 17499-1-AP

  IP result of anti-MYO1A (IP:17499-1-AP, 4ug; Detection:17499-1-AP 1:500) with HeLa cells lysate 3200ug.

• 

  IHC staining of human colon cancer using 17499-1-AP

  Immunohistochemical analysis of paraffin-embedded Colorectal cancer slide using 17499-1-AP (MYO1A antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human kidney using 17499-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney using 17499-1-AP (MYO1A antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human kidney using 17499-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney using 17499-1-AP (MYO1A antibody) at dilution of 1:100 (under 40x lens).

• 

  IF Staining of HepG2 using 17499-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using MYO1A antibody (17499-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-phalloidin (red).

• 

  IF Staining of HeLa using 17499-1-AP

  Immunofluorescent analysis of Hela cells, using MYO1A antibody 17499-1-AP at 1:25 dilution and Rhodamine-labeled goat anti-rabbit IgG (red).

• Featured Product
• KD/KO Validated

MYO1A Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 17499-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

MIHC, DFNA48, Brush border myosin I, BBM-I, BBMI

---

Tested Applications

• Positive WB detected in: mouse brain tissue, HepG2 cells, HeLa cells, A431 cells
• Positive IP detected in: HeLa cells
• Positive IHC detected in: human colon cancer tissue, human kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells, HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below

Product Information

17499-1-AP targets MYO1A in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11682

  Product name: Recombinant human MYO1A protein

  Source: e coli.-derived, T-HIS

  Tag: 6*His

  Domain: 1-350 aa of BC059387

  Sequence: MPLLEGSVGVEDLVLLEPLVEESLLKNLQLRYENKEIYTYIGNVVISVNPYQQLPIYGPEFIAKYQDYTFYELKPHIYALANVAYQSLRDRDRDQCILITGESGSGKTEASKLVMSYVAAVCGKGEQVNSVKEQLLQSNPVLEAFGNAKTIRNNNSSRFGKYMDIEFDFKGSPLGGVITNYLLEKSRLVKQLKGERNFHIFYQLLAGADEQLLKALKLERDTTGYAYLNHEVSRVDGMDDASSFRAVQSAMAVIGFSEEEIRQVLEVTSMVLKLGNVLVADEFQASGIPASGIRDGRGVREIGEMVGLNSEEVERALCSRTMETAKEKVVTALNVMQAQYARDALAKNIY

• Full Name: myosin IA
• Calculated Molecular Weight: 1043 aa, 118 kDa
• Observed Molecular Weight: 130 kDa
• GenBank Accession Number: BC059387
• Gene Symbol: MYO1A
• Gene ID (NCBI): 4640
• RRID: AB_2148172
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UBC5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
	WB	Cell Rep Med; Personalized drug screening using patient-derived organoid and its clinical relevance in gastric cancer; Authors - Yi Zhao
mouse	WB	Clin Sci (Lond); A new mechanism of arterial calcification in diabetes: interaction between H3K18 lactylation and CHI3L1; Authors - Yi Zhu