Tested Applications
| Positive WB detected in | BGC-823 cells, HEK-293 cells, HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:5000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 1 publications below |
Product Information
29442-1-AP targets SLC4A7/NBCn1 in WB, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag30545 Product name: Recombinant human SLC4A7 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 119-237 aa of NM_003615 Sequence: LCYRDGEEYEWKETARWLKFEEDVEDGGDRWSKPYVATLSLHSLFELRSCILNGTVMLDMRASTLDEIADMVLDNMIASGQLDESIRENVREALLKRHHHQNEKRFTSRIPLVRSFADI Predict reactive species |
| Full Name | solute carrier family 4, sodium bicarbonate cotransporter, member 7 |
| Calculated Molecular Weight | 136 kDa |
| Observed Molecular Weight | 136 kDa |
| GenBank Accession Number | NM_003615 |
| Gene Symbol | NBCn1/SLC4A7 |
| Gene ID (NCBI) | 9497 |
| RRID | AB_3086133 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9Y6M7 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SLC4A7 also known as NBCn1, NBC3, NBC2, is an electroneutral Na(+)/HCO(3)(-) cotransporter (PMID: 14736710). SLC4A7 mediates the coupled movement of sodium and bicarbonate ions across the plasma membrane. SLC4A7 plays a key role in macrophage acidification, mediating bicarbonate import into the cytoplasm which is crucial for net acid extrusion and maintenance of cytoplasmic pH during phagocytosis (PubMed:29779931). SLC4A7 is expressed in testis, spleen, and retina. SLC4A7 may be a major regulator of extracellular pH of retina where light stimulation produces an extracellular alkalization and may contribute as a solute transporter to the prevention of retinal detachment(PMID: 9610397).
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for SLC4A7/NBCn1 antibody 29442-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
