Tested Applications
| Positive WB detected in | HeLa cells, COS-7 cells |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | mouse heart tissue, human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
16004-1-AP targets NBR1 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat, monkey samples.
| Tested Reactivity | human, mouse, rat, monkey |
| Cited Reactivity | human, mouse, pig, canine, monkey |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag8652 Product name: Recombinant human NBR1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-353 aa of BC009808 Sequence: MEPQVTLNVTFKNEIQSFLVSDPENTTWADIEAMVKVSFDLNTIQIKYLDEENEEVSINSQGEYEEALKMAVKQGNQLQMQVHEGHHVVDEAPPPVVGAKRLAARAGKKPLAHYSSLVRVLGSDMKTPEDPAVQSFPLVPCDTDQPQDKPPDWFTSYLETFREQVVNETVEKLEQKLHEKLVLQNPSLGSCPSEVSMPTSEETLFLPENQFSWHIACNNCQRRIVGVRYQCSLCPSYNICEDCEAGPYGHDTNHVLLKLRRPVVGSSEPFCHSKYSTPRLPAALEQVRLQKQVDKNFLKAEKQRLRAEKKQRKAEVKELKKQLKLHRKIHLWNSIHGLQSPKSPLGRPESLLQ Predict reactive species |
| Full Name | neighbor of BRCA1 gene 1 |
| Calculated Molecular Weight | 966 aa, 107 kDa |
| Observed Molecular Weight | 140 kDa |
| GenBank Accession Number | BC009808 |
| Gene Symbol | NBR1 |
| Gene ID (NCBI) | 4077 |
| RRID | AB_2251178 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q14596 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
NBR1, also named as 1A13B, KIAA0049 and M17S2, acts probably as a receptor for selective autophagosomal degradation of ubiquitinated targets. NBR1 and P62 can bind to autophagic effector proteins (Atg8 in yeast, MAP1LC3 protein family in mammals) anchored in the membrane of autophagosomes. It is a highly conserved multidomain scaffold protein with proposed roles in endocytic trafficking and selective autophagy. NBR1 is a novel PB1 adapter in Th2 differentiation and asthma. It functions as an autophagy receptor involved in targeting ubiquitinated proteins for degradation. It also has a dual role as a scaffold protein to regulate growth-factor receptor and downstream signaling pathways. Observed MW of NBR1 is 140 kDa (PMID: 22654911, PMID: 22484440).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for NBR1 antibody 16004-1-AP | Download protocol |
| IHC protocol for NBR1 antibody 16004-1-AP | Download protocol |
| IP protocol for NBR1 antibody 16004-1-AP | Download protocol |
| WB protocol for NBR1 antibody 16004-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The NBR1 polyclonal antibody (Cat# 16004-1-AP) has 78 citations published in journals including Cell, Nature Cell Biology, Autophagy, Nature Communications, Molecular Cell, Acta Neuropathologica, Journal of Experimental & Clinical Cancer Research, and Advanced Science. Associated research fields encompass selective autophagy, pexophagy, mitophagy, neurodegenerative diseases (Parkinson's, Alzheimer's), cancer biology, viral infection mechanisms, inflammatory signaling, and cellular metabolic regulation.
| Species | Application | Title |
|---|---|---|
Cell Lack of Neuronal IFN-β-IFNAR Causes Lewy Body- and Parkinson's Disease-like Dementia. | ||
Nat Aging Hypoxia-induced autophagic degradation of HIF-1α attenuates cellular aging and extends mammalian lifespan. | ||
Nat Cell Biol The Troyer syndrome protein spartin mediates selective autophagy of lipid droplets | ||
Autophagy Autophagy receptor OPTN (optineurin) regulates mesenchymal stem cell fate and bone-fat balance during aging by clearing FABP3. |
Reviews
What customers say
One user reviewed this product for Western Blot on murine testes tissue at a 1:500 dilution, giving it a 5-star rating. They reported that it "works great" and produces a clean band. Overall, the single review reflects high satisfaction with the antibody's performance in WB applications.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Zaile (Verified Customer) (04-22-2026) | It works great, give a clean band.
|
