• Featured Product
  • KD/KO Validated

CoraLite®594-conjugated NBR1 Polyclonal antibody

NBR1 Polyclonal Antibody for IF/ICC, FC (Intra)
Cat No. CL594-16004

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, monkey

Applications

IF/ICC, FC (Intra)

1A1 3B, 1A13B, Cell migration-inducing gene 19 protein, FLJ55359, M17S2

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHeLa cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL594-16004 targets NBR1 in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse, rat, monkey samples.

Tested Reactivity human, mouse, rat, monkey
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag8652

Product name: Recombinant human NBR1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-353 aa of BC009808

Sequence: MEPQVTLNVTFKNEIQSFLVSDPENTTWADIEAMVKVSFDLNTIQIKYLDEENEEVSINSQGEYEEALKMAVKQGNQLQMQVHEGHHVVDEAPPPVVGAKRLAARAGKKPLAHYSSLVRVLGSDMKTPEDPAVQSFPLVPCDTDQPQDKPPDWFTSYLETFREQVVNETVEKLEQKLHEKLVLQNPSLGSCPSEVSMPTSEETLFLPENQFSWHIACNNCQRRIVGVRYQCSLCPSYNICEDCEAGPYGHDTNHVLLKLRRPVVGSSEPFCHSKYSTPRLPAALEQVRLQKQVDKNFLKAEKQRLRAEKKQRKAEVKELKKQLKLHRKIHLWNSIHGLQSPKSPLGRPESLLQ

Predict reactive species
Full Name neighbor of BRCA1 gene 1
Calculated Molecular Weight 966 aa, 107 kDa
Observed Molecular Weight 140 kDa
GenBank Accession NumberBC009808
Gene Symbol NBR1
Gene ID (NCBI) 4077
RRIDAB_2919827
Conjugate CoraLite®594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths588 nm / 604 nm
Excitation LaserYellow-Green Laser (561 nm)
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ14596
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

NBR1, also named as 1A13B, KIAA0049 and M17S2, acts probably as a receptor for selective autophagosomal degradation of ubiquitinated targets. NBR1 and P62 can bind to autophagic effector proteins (Atg8 in yeast, MAP1LC3 protein family in mammals) anchored in the membrane of autophagosomes. It is a highly conserved multidomain scaffold protein with proposed roles in endocytic trafficking and selective autophagy. NBR1 is a novel PB1 adapter in Th2 differentiation and asthma. It functions as an autophagy receptor involved in targeting ubiquitinated proteins for degradation. It also has a dual role as a scaffold protein to regulate growth-factor receptor and downstream signaling pathways. Observed MW of NBR1 is 140 kDa (PMID: 22654911, PMID: 22484440).

Protocols

Product Specific Protocols
FC protocol for CL594 NBR1 antibody CL594-16004Download protocol
IF protocol for CL594 NBR1 antibody CL594-16004Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...