Recombinant human NCR3 protein
Source
e coli.-derived, PET30a
Tag
6*His
Format
Liquid
Cat no : Ag24778
Synonyms
NCR3, 1C7, CD337, LY117, MALS
Validation Data Gallery View All
Product Information
| Peptide Sequence |
PEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVVPGKEVRNGTPEFRGRLAPLASSRFLHDHQAELHIRDVRGHDASIYVCRVEVLGLGVGTGNGTRLVVEKEHPQL
(25-134 aa encoded by BC052582) |
| Activity | Not tested. |
| Endotoxin Level | Please contact the lab for more information. |
