Tested Applications
| Positive WB detected in | A549 cells, C6 cells, HeLa cells, HT-1080 cells, HEK-293 cells, Jurkat cells, NIH/3T3 cells, COS-7 cells |
| Positive IP detected in | C6 cells |
| Positive IHC detected in | human breast cancer tissue, human lung cancer tissue, human liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | U2OS cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:8000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
21698-1-AP targets NEDD4 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat, monkey samples.
| Tested Reactivity | human, mouse, rat, monkey |
| Cited Reactivity | human, mouse, rat, monkey, chicken, bovine |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag16291 Product name: Recombinant human NEDD4 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 970-1319 aa of BC152452 Sequence: TVLEDSYRRIMGVKRADFLKARLWIEFDGEKGLDYGGVAREWFFLISKEMFNPYYGLFEYSATDNYTLQINPNSGLCNEDHLSYFKFIGRVAGMAVYHGKLLDGFFIRPFYKMMLHKPITLHDMESVDSEYYNSLRWILENDPTELDLRFIIDEELFGQTHQHELKNGGSEIVVTNKNKKEYIYLVIQWRFVNRIQKQMAAFKEGFFELIPQDLIKIFDENELELLMCGLGDVDVNDWREHTKYKNGYSANHQVIQWFWKAVLMMDSEKRIRLLQFVTGTSRVPMNGFAELYGSNGPQSFTVEQWGTPEKLPRAHTCFNRLDLPPYESFEELWDKLQMAIENTQGFDGVD Predict reactive species |
| Full Name | neural precursor cell expressed, developmentally down-regulated 4 |
| Calculated Molecular Weight | 1319 aa, 149 kDa |
| Observed Molecular Weight | 115 kDa |
| GenBank Accession Number | BC152452 |
| Gene Symbol | NEDD4 |
| Gene ID (NCBI) | 4734 |
| RRID | AB_10858626 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P46934 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
NEDD4 and similar proteins discovered subsequently became a family of HECT ligases, comprising 9 human proteins including NEDD4, NEDD4-2 (NEDD4L), ITCH, SMURF1, SMURF2, WWP1, WWP2, NEDL1 and NEDL2 (PMID: 23545411). NEDD4 is a highly evolutionarily conserved protein from yeast to man, and was initially cloned as a highly expressed gene in the early embryonic brain (PMID: 35328067). NEDD4 is frequently overexpressed in many different types of cancer, and decreased levels of NEDD4 can also be associated with cancer. It can be a potential therapeutic target for the treatment of human cancer.(PMID: 25527121). The human NEDD4 gene is located on chromosome 15q21.3 and comprises 30 exons (HGNC:7727) shown to encode a ~120 KDa protein. Otherwise there is a 75 kDa isoform in addition to full length NEDD4 (PMID: 24907641).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for NEDD4 antibody 21698-1-AP | Download protocol |
| IHC protocol for NEDD4 antibody 21698-1-AP | Download protocol |
| IP protocol for NEDD4 antibody 21698-1-AP | Download protocol |
| WB protocol for NEDD4 antibody 21698-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The NEDD4 Polyclonal antibody (Cat# 21698-1-AP) has accumulated 92 citations published in journals including Nature Cancer, Nature Communications, Autophagy, Cell Reports, Cell Death & Differentiation, Advanced Science, and Nucleic Acids Research. Associated research fields encompass oncology (breast, lung, pancreatic, liver, colorectal cancers), ubiquitin-proteasome pathways, autophagy, ferroptosis, neurodegeneration (Parkinson's, Huntington's disease), cardiovascular disease, diabetes, viral infections, inflammation, and immune regulation. Primary applications include Western blot, immunofluorescence, and co-immunoprecipitation.
| Species | Application | Title |
|---|---|---|
Nat Cancer Inhibition of ADAM9 promotes the selective degradation of KRAS and sensitizes pancreatic cancers to chemotherapy | ||
Autophagy The matrix protein of lyssavirus hijacks autophagosome for efficient egress by recruiting NEDD4 through its PPxY motif | ||
Autophagy CX3CR1(+) macrophages aggravate doxorubicin-induced cardiomyopathy by impairing cardiac mitophagy via the CSF1R-PARP1-IL1B axis. | ||
Autophagy A CRISPR-Cas9 screen identifies LAPTM4A (lysosomal protein transmembrane 4 alpha) as a key host barrier against PRRSV infection. | ||
Nat Commun Lack of intestinal Mucin-1 impairs intestinal epithelial barrier and promotes metabolic dysfunction-associated steatotic liver disease in male mice.
| ||
Nat Commun The E3 ubiquitin ligase FBXL18 stabilizes BST2 to promote inflammation in RABV-infected astrocytes |
Reviews
What customers say
All three reviews rate this NEDD4 antibody 5 stars for Western Blot. Users consistently report strong, clear bands and reliable detection of endogenous NEDD4. It performed well in mouse heart tissue, mouse brain lysate, and heart samples. Recommended dilutions were 1:1000 and 1:2000. Overall, customers describe it as a good, effective antibody for probing NEDD4 by WB.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Xinyi (Verified Customer) (08-28-2026) | Nedd4 antibody is strong and show clear bands.
|
CaX (Verified Customer) (09-01-2025) | A good antibody to probe endogenous NEDD4.
 |
Tongbin (Verified Customer) (08-25-2020) | This NEDD4 antibody works very well in western blots.
|
