• Featured Product
  • KD/KO Validated

NEDD8 Polyclonal antibody

NEDD8 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 16777-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, monkey

Applications

WB, IHC, IF/ICC, ELISA

cul nedd8, FLJ43224, Nedd 8, NEDD-8, Neddylin

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse brain tissue, human heart tissue
Positive IHC detected inhuman prostate cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunohistochemistry (IHC)IHC : 1:250-1:1000
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

16777-1-AP targets NEDD8 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat, monkey samples.

Tested Reactivity human, mouse, rat, monkey
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag10154

Product name: Recombinant human NEDD8 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-81 aa of BC104664

Sequence: MLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVLHLVLALRGGGGLRQ

Predict reactive species
Full Name neural precursor cell expressed, developmentally down-regulated 8
Calculated Molecular Weight 81 aa, 9 kDa
Observed Molecular Weight 6-10 kDa
GenBank Accession NumberBC104664
Gene Symbol NEDD8
Gene ID (NCBI) 4738
RRIDAB_10598467
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ15843
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NEDD8 (neural precursor cell-expressed developmentally down-regulated gene 8) is a small ubiquitin-like protein that shares 60% sequence identity and 80% homology with ubiquitin [PMID:9353319]. NEDD8 is conjugated to substrate proteins in a process known as neddylation. NEDD8 forms a thioester bond with APPBP1-Uba3, the E1 enzyme. Activated NEDD8 then transfers to Ubc12, the E2 enzyme . Ultimately, E2 loaded with NEDD8 binds a substrate protein lysine residue and forms an isopeptide bond by E3 ligase [PMID:18802447].

Protocols

Product Specific Protocols
IHC protocol for NEDD8 antibody 16777-1-APDownload protocol
WB protocol for NEDD8 antibody 16777-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle

Nat Neurosci

Identification of NUB1 as a suppressor of mutant Huntington toxicity via enhanced protein clearance.

Authors - Lu Boxun B
humanWB

J Transl Med

TC2N inhibits distant metastasis and stemness of breast cancer via blocking fatty acid synthesis

Authors - Xiang-Lin Hao
ratWB,IF

Neuropsychopharmacology

Synaptic control of DNA methylation involves activity-dependent degradation of DNMT3A1 in the nucleus.

Authors - Gonca Bayraktar
  • KD Validated

J Med Chem

Halo and Pseudohalo Gold(I)-NHC Complexes Derived from 4,5-Diarylimidazoles with Excellent in Vitro and in Vivo Anticancer Activity Against HCC.

Authors - Mianli Bian
humanWB

Front Bioeng Biotechnol

Let-7i-5p Regulation of Cell Morphology and Migration Through Distinct Signaling Pathways in Normal and Pathogenic Urethral Fibroblasts.

Authors - Kaile Zhang
humanIHC

J Exp Clin Cancer Res

Neddylation activated TRIM25 desensitizes triple-negative breast cancer to paclitaxel via TFEB-mediated autophagy

Authors - Bowen Zheng

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Jose (Verified Customer) (09-14-2021)

Strong signal

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
Loading...
||
New chat Able
正在加载,请稍候...