• Featured Product
  • KD/KO Validated

NF-κB p65 Recombinant monoclonal antibody

NF-κB p65 Uni-rAb® Recombinant Antibody for WB, IF/ICC, FC (Intra), IP, ELISA, ChIP-qPCR
Cat No. 80979-1-RR
Clone No.4C7

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF/ICC, FC (Intra), IP, ELISA, ChIP-qPCR

NF κB, p65, p65; RELA, RELA, 4C7

Formulation:  PBS and Azide
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, HEK-293 cells, MCF-7 cells, MOLT-4 cells, Jurkat cells, Raji cells, NIH/3T3 cells, HSC-T6 cells
Positive IP detected inHeLa cells
Positive IF/ICC detected inHepG2 cells, TNF alpha treated HT-1080 cells
Positive FC (Intra) detected inHepG2 cells
Positive ChIP-qPCR detected inhTNF-α-HeLa, 30 ng/ml, 1 h HeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:40000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunofluorescence (IF)/ICCIF/ICC : 1:125-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
CHIP-QPCRCHIP-QPCR : 1:10-1:100
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

80979-1-RR targets NF-κB p65 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA, ChIP-qPCR applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, pig
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag1199

Product name: Recombinant human p65; RELA protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-220 aa of BC011603

Sequence: MDELFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPTIKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQCVKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPSGRPLRLPPVLSHPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQ

Predict reactive species
Full Name v-rel reticuloendotheliosis viral oncogene homolog A (avian)
Calculated Molecular Weight 65 kDa
Observed Molecular Weight65 kDa
GenBank Accession NumberBC011603
Gene Symbol NF-κB p65
Gene ID (NCBI) 5970
RRIDAB_2918923
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ04206
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Nuclear factor kB (NF-kB) is a sequence-specific DNA-binding protein complex which regulates the expression of viral genomes, including the human immunodeficiency virus, and a variety of cellular genes, particularly those involved in immune and inflammatory responses. The members of the NF-kB family in mammalian cells include the proto-oncogene c-Rel,p50/p105 (NFkB1), p65 (RelA), p52/p100 (NFkB2), and RelB. All of these proteins share a conserved 300-amino acid region known as the Rel homology domain which is responsible for DNA binding, dimerization, and nuclear translocation of NF-kB. The p65 subunit is a major component of NF-kB complexes and is responsible for trans-activation. NF-kB heterodimeric p65-p50 and p65-c-Rel complexes are transcriptional activators. The NF-kB p65-p65 complex appears to be involved in invasin-mediated activation of IL-8 expression. The inhibitory effect of IkB upon NF-kB the cytoplasm is exerted primarily through the interaction with p65. p65 shows a weak DNA-binding site which could contribute directly to DNA binding in the NF-kB complex. It associates with chromatin at the NF-kB promoter region via association with DDX1. This antibody is a rabbit monoclonal antibody raised against residues near the N terminus of human RELA.

Protocols

Product Specific Protocols
WB protocol for NF-κB p65 antibody 80979-1-RRDownload protocol
IF protocol for NF-κB p65 antibody 80979-1-RRDownload protocol
IP protocol for NF-κB p65 antibody 80979-1-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseWB

Adv Sci (Weinh)

Ccl2-Induced Regulatory T Cells Balance Inflammation Through Macrophage Polarization During Liver Reconstitution

Authors - Rui Wang
mouseWB

Small

Polymer-Encapsulated Catalase for Targeted Redox Regulation in Acute Liver Injury

Authors - Feifei Li
mouseWB

Redox Biol

Deficiency of S100 calcium binding protein A9 attenuates vascular dysfunction in aged mice

Authors - Boying Zhao
mouse

J Exp Clin Cancer Res

METTL3 recruiting M2-type immunosuppressed macrophages by targeting m6A-SNAIL-CXCL2 axis to promote colorectal cancer pulmonary metastasis

Authors - Peng Ouyang
mouseWB

Carbohydr Polym

Structural characterizations and antiaging activities of hydrolyzed low-molecular-weight polysaccharides from Polygoni Multiflori Radix Praeparata

Authors - Wei Xu
mouseWB

Sci Total Environ

Effects of chronic low-level lead (Pb) exposure on cognitive function and hippocampal neuronal ferroptosis: An integrative approach using bioinformatics analysis, machine learning, and experimental validation

Authors - Yingsi Cao
Loading...
||
New chat Able
正在加载,请稍候...