Tested Applications
Positive WB detected in | HeLa cells, HEK-293 cells, MCF-7 cells, MOLT-4 cells, Jurkat cells, Raji cells, NIH/3T3 cells, HSC-T6 cells |
Positive IP detected in | HeLa cells |
Positive IF/ICC detected in | HepG2 cells, TNF alpha treated HT-1080 cells |
Positive FC (Intra) detected in | HepG2 cells |
Positive ChIP-qPCR detected in | hTNF-α-HeLa, 30 ng/ml, 1 h HeLa cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:5000-1:40000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
Immunofluorescence (IF)/ICC | IF/ICC : 1:125-1:500 |
Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
CHIP-QPCR | CHIP-QPCR : 1:10-1:100 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 100 publications below |
IHC | See 1 publications below |
IF | See 21 publications below |
Product Information
80979-1-RR targets NF-κB p65 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA, ChIP-qPCR applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse, rat, pig |
Host / Isotype | Rabbit / IgG |
Class | Recombinant |
Type | Antibody |
Immunogen |
CatNo: Ag1199 Product name: Recombinant human p65; RELA protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-220 aa of BC011603 Sequence: MDELFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPTIKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQCVKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPSGRPLRLPPVLSHPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQ Predict reactive species |
Full Name | v-rel reticuloendotheliosis viral oncogene homolog A (avian) |
Calculated Molecular Weight | 65 kDa |
Observed Molecular Weight | 65 kDa |
GenBank Accession Number | BC011603 |
Gene Symbol | NF-κB p65 |
Gene ID (NCBI) | 5970 |
RRID | AB_2918923 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | Q04206 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Nuclear factor kB (NF-kB) is a sequence-specific DNA-binding protein complex which regulates the expression of viral genomes, including the human immunodeficiency virus, and a variety of cellular genes, particularly those involved in immune and inflammatory responses. The members of the NF-kB family in mammalian cells include the proto-oncogene c-Rel,p50/p105 (NFkB1), p65 (RelA), p52/p100 (NFkB2), and RelB. All of these proteins share a conserved 300-amino acid region known as the Rel homology domain which is responsible for DNA binding, dimerization, and nuclear translocation of NF-kB. The p65 subunit is a major component of NF-kB complexes and is responsible for trans-activation. NF-kB heterodimeric p65-p50 and p65-c-Rel complexes are transcriptional activators. The NF-kB p65-p65 complex appears to be involved in invasin-mediated activation of IL-8 expression. The inhibitory effect of IkB upon NF-kB the cytoplasm is exerted primarily through the interaction with p65. p65 shows a weak DNA-binding site which could contribute directly to DNA binding in the NF-kB complex. It associates with chromatin at the NF-kB promoter region via association with DDX1. This antibody is a rabbit monoclonal antibody raised against residues near the N terminus of human RELA.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for NF-κB p65 antibody 80979-1-RR | Download protocol |
IF protocol for NF-κB p65 antibody 80979-1-RR | Download protocol |
IP protocol for NF-κB p65 antibody 80979-1-RR | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Adv Sci (Weinh) Ccl2-Induced Regulatory T Cells Balance Inflammation Through Macrophage Polarization During Liver Reconstitution | ||
Redox Biol Deficiency of S100 calcium binding protein A9 attenuates vascular dysfunction in aged mice | ||
J Exp Clin Cancer Res METTL3 recruiting M2-type immunosuppressed macrophages by targeting m6A-SNAIL-CXCL2 axis to promote colorectal cancer pulmonary metastasis | ||
Carbohydr Polym Structural characterizations and antiaging activities of hydrolyzed low-molecular-weight polysaccharides from Polygoni Multiflori Radix Praeparata | ||
Sci Total Environ Effects of chronic low-level lead (Pb) exposure on cognitive function and hippocampal neuronal ferroptosis: An integrative approach using bioinformatics analysis, machine learning, and experimental validation |