NKX2-2 Polyclonal antibody

• 

  WB analysis of Min6 cells using 13013-1-AP

  WB result of NKX2-2 antibody (13013-1-AP) on Min6 cells with siNKX2-2, siPAX4, siNKX6-1 by Dr. Nicholas George, Sarvetnick Lab – UNMC. (the 70 kDa band is unknown).

• 

  IHC staining of mouse brain using 13013-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 13013-1-AP (NKX2-2 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 13013-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 13013-1-AP (NKX2-2 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of E16.5 mouse pancreas tissue using 13013-1-AP

  IF result (trunk or trunck-associated region; nucleus stain; RED) of NKX2-2 antibody (13013-1-AP) with E16.5 mouse pancreas by Dr. Nicholas George, Sarvetnick Lab – UNMC. (Green, E-Cadherin; RED, NKX2-2; Blue, DAPI).

NKX2-2 Polyclonal Antibody for WB, IHC, IF, ELISA

Cat No. 13013-1-AP

Publications(9)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF, ChIP, ELISA

Synonyms

NKX2B, NKX2.2, NKX2 2, Homeobox protein Nkx-2.2, Homeobox protein Nkx 2.2

---

Tested Applications

• Positive WB detected in: Min6 cells
• Positive IHC detected in: mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF detected in: E16.5 mouse pancreas tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:250-1:1000
• Immunofluorescence (IF): IF : 1:20 - 1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 6 publications below
• IF: See 3 publications below
• ChIP: See 1 publications below

Product Information

13013-1-AP targets NKX2-2 in WB, IHC, IF, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, pig
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4069

  Product name: Recombinant human NKX2-2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-129 aa of BC075092

  Sequence: MSLTNTKTGFSVKDILDLPDTNDEEGSVAEGPEEENEGPEPAKRAGPLGQGALDAVQSLPLKNPFYDSSDNPYTRWLASTEGLQYSLHGLAAGAPPQDSSSKSPEPSADESPDNDKETPGGGGDAGKKR

• Full Name: NK2 homeobox 2
• Calculated Molecular Weight: 273 aa, 30 kDa
• Observed Molecular Weight: 30 kDa
• GenBank Accession Number: BC075092
• Gene Symbol: NKX2-2
• Gene ID (NCBI): 4821
• RRID: AB_2877903
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O95096
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Dev Cell; Nuclear import carrier Hikeshi cooperates with HSP70 to promote murine oligodendrocyte differentiation and CNS myelination; Authors - Li Li
human	WB	Nucleic Acids Res; EWS-FLI1 regulates and cooperates with core regulatory circuitry in Ewing sarcoma.; Authors - Xianping Shi
mouse	IF	Cell Rep; Spatiotemporal role of SETD2-H3K36me3 in murine pancreatic organogenesis; Authors - Ping Lu
human	WB	Cells; Development of a Chemical Cocktail That Rescues Mouse Brain Demyelination in a Cuprizone-Induced Model.; Authors - Pei-Lun Lai
rat	WB	J Ethnopharmacol; Shenzhiling oral liquid protects the myelin sheath against Alzheimer's disease through the PI3K/Akt-mTOR pathway.; Authors - Mingcui Zheng
human	WB	J Cancer; NK homeobox 2.2 functions as tumor suppressor in colorectal cancer due to DNA methylation.; Authors - Yuan He