NOM1 Polyclonal antibody, PBS Only

• 

  WB analysis using 29798-1-AP (same clone as 29798-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 29798-1-AP (NOM1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 29798-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse cerebellum using 29798-1-AP (same clone as 29798-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 29798-1-AP (NOM1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29798-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse cerebellum using 29798-1-AP (same clone as 29798-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 29798-1-AP (NOM1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29798-1-PBS in a different storage buffer formulation.

NOM1 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 29798-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

29798-1-PBS targets NOM1 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag31423

  Product name: Recombinant human NOM1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-205 aa of NM_138400

  Sequence: MAASRSAGEAGPGGSQGRVVRMKRRGGRGPRRGPAGGGEKALKRLKLAVEEFVHATSEGEAPGGCEGRGAPVSFRPGGRKSRKELRKEKRHLRKARRLQRTAGPEQGPGLGGRSGAEEASGHRQDTEERARPAPSRDPSPPRKPRPSRVKAKATAATAKTRPSAAATAAARKRALLAANEEEDREIRKLERCLGLNKRKKKDGSS

• Full Name: nucleolar protein with MIF4G domain 1
• Calculated Molecular Weight: 96KD
• Observed Molecular Weight: 96~100 kDa
• GenBank Accession Number: NM_138400
• Gene Symbol: NOM1
• Gene ID (NCBI): 64434
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q5C9Z4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Nucleolar protein NOM1, which contains an MIF4G domain and an MA3 domain, was first isolated from the bone marrow of children with acute myeloid leukemia. NOM1 is highly conserved in a variety of species, including in yeast and in humans.