eNOS Polyclonal antibody

• 

  WB analysis using 27120-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27120-1-AP (NOS3 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 27120-1-AP

  bEnd.3 cells were subjected to SDS PAGE followed by western blot with 27120-1-AP (eNOS antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse liver using 27120-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 27120-1-AP (eNOS antibody) at dilution of 1:450 incubated at room temperature for 1.5 hours.

eNOS Polyclonal Antibody for WB, ELISA

Cat No. 27120-1-AP

Publications(74)

Host / Isotype

Rabbit / IgG

Reactivity

mouse, rat and More (2)

Applications

WB, IHC, IF, ELISA

Synonyms

cNOS, Constitutive NOS, EC NOS, ECNOS, Endothelial NOS, eNOS, NOS type III, NOS3, NOSIII

---

Tested Applications

• Positive WB detected in: mouse liver tissue, bEnd.3 cells, mouse kidney tissue, rat kidney tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 64 publications below
• IHC: See 8 publications below
• IF: See 8 publications below

Product Information

27120-1-AP targets eNOS in WB, IHC, IF, ELISA applications and shows reactivity with mouse, rat samples.

• Tested Reactivity: mouse, rat
• Cited Reactivity: human, mouse, rat, pig
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25712

  Product name: Recombinant human NOS3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-120 aa of

  Sequence: MGNLKSVAQEPGPPCGLGLGLGLGLCGKQGPATPAPEPSRAPASLLPPAPEHSPPSSPLTQPPEGPKFPRVKNWEVGSITYDTLSAQAQQDGPCTPRRCLGSLVFPRKLQGRPSPGPPAP

• Full Name: nitric oxide synthase 3 (endothelial cell)
• Observed Molecular Weight: 133 kDa, 69 kDa
• Gene Symbol: eNOS
• Gene ID (NCBI): 4846
• RRID: AB_2880764
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P29474
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Endothelial NOS(eNOS), also known as nitric oxide synthase 3(NOS3), has a protective function in the cardiovascular system, which is attributed to NO production. NOS3 has 3 isoforms of 68, 69, 133 kDa. Polymorphisms in NOS3 gene affects the susceptibility to several diseases such as hypertension, preeclampsia, diabetes mellitus, obesity, erectile dysfunction, and migraine.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Redox Biol; Exercise protects aged mice against coronary endothelial senescence via FUNDC1-dependent mitophagy; Authors - Lijie Ma
mouse	WB	Redox Biol; Non-steroidal mineralocorticoid receptor antagonist finerenone ameliorates mitochondrial dysfunction via PI3K/Akt/eNOS signaling pathway in diabetic tubulopathy; Authors - Lan Yao
human	WB	Acta Biomater; Substrate stiffness regulates differentiation of induced pluripotent stem cells into heart valve endothelial cells.; Authors - Hong Cao
human	WB	Hypertension; Statins Prevent the Deleterious Consequences of Placental Chemerin Upregulation in Preeclampsia; Authors - Lunbo Tan
human	WB	Int J Biol Macromol; Selection of goat β-casein derived ACE-inhibitory peptide SQPK and insights into its effect and regulatory mechanism on the function of endothelial cells; Authors - Yulong Wu
rat	WB	Oxid Med Cell Longev; Tissue Kallikrein Protects Rat Prostate against the Inflammatory Damage in a Chronic Autoimmune Prostatitis Model via Restoring Endothelial Function in a Bradykinin Receptor B2-Dependent Way.; Authors - Mengyang Zhang