Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

B23/NPM1 Monoclonal antibody

B23/NPM1 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 60096-1-Ig
Clone No. 4F12A3
Publications (65)
Reviews (1)
Download datasheet

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, CoIP, ChIP, ELISA
For FC, select conjugated version.

B23, NPM1, 4F12A3, NPM, Nucleophosmin

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for B23/NPM1 in ?

Tested Applications

Positive WB detected inHSC-T6 cells, C6 cells, HeLa cells, HepG2 cells, LNCaP cells, NIH/3T3 cells, RAW 264.7 cells, ROS1728 cells, MCF-7 cells, HEK-293 cells, Jurkat cells, K-562 cells
Positive IHC detected inhuman breast cancer tissue, human colon cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells, MCF-7 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:200-1:1000
Immunofluorescence (IF)/ICCIF/ICC : 1:400-1:1600
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

60096-1-Ig targets B23/NPM1 in WB, IHC, IF/ICC, IP, CoIP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag7415

Product name: Recombinant human B23 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-293 aa of BC002398

Sequence: MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEEEEDVKLLSISGKRSAPGGGSKVPQKKVKLAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVKKSIRDTPAKNAQKSNQNGKDSKPSSTPRSKGQESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKS

Predict reactive species
Full Name nucleophosmin (nucleolar phosphoprotein B23, numatrin)
Calculated Molecular Weight 33 kDa
Observed Molecular Weight 35-38 kDa
GenBank Accession NumberBC002398
Gene Symbol NPM1
Gene ID (NCBI) 4869
RRIDAB_2155162
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP06748
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Nucleophosmin (NPM1,B23) is a putative ribosome assembly factor with a high affinity for peptides containing nuclear localization signals (NLSs). The transport of proteins across the nuclear envelope is a selective, multistep process involving several cytoplasmic factors. Proteins must be recognized as import substrates, dock at the nuclear pore complex and translocate across the nuclear envelope in an ATP-dependent fashion. Several cytosolic and nuclear proteins that are central to this process have been identified. The 38 kDa nuclear protein nucleophosmin is involved in ribosomal assembly and rRNA transport. It is an abundant protein that is highly phosphorylated by Cdc2 kinase during mitosis.

Protocols

Product Specific Protocols
IF protocol for B23/NPM1 antibody 60096-1-IgDownload protocol
IHC protocol for B23/NPM1 antibody 60096-1-IgDownload protocol
WB protocol for B23/NPM1 antibody 60096-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

60096-1-Ig is an anti-NPM1 (Nucleophosmin 1) antibody with 65 total citations. Citations appear in journals including Nature Communications, Nature Metabolism, Molecular Cell, Brain, Science Advances, Cell Reports, Oncogene, and iScience, among others. Research fields span oncology (various solid tumors and leukemias), neurodegenerative diseases (ALS, FTD, Alzheimer's), nucleolar biology, RNA processing, ribosome biogenesis, signal transduction, and epigenetics. Applications include WB, IF, IHC, IP, CoIP, and ChIP.

SpeciesApplicationTitle
humanWB

Signal Transduct Target Ther

PKMYT1 kinase ameliorates cisplatin sensitivity in osteosarcoma

Authors - Binfeng Liu
humanWB

J Hepatol

Nucleolin lactylation contributes to intrahepatic cholangiocarcinoma pathogenesis via RNA splicing regulation of MADD

Authors - Long Yang
humanWB

Nat Metab

Myc-mediated SDHA acetylation triggers epigenetic regulation of gene expression and tumorigenesis.

Authors - Shi-Ting Li
humanWB,IF

Mol Neurodegener

Nuclear speckle specific hnRNP D-like prevents age- and AD-related cognitive decline by modulating RNA splicing.

Authors - Qingyang Zhang
humanIP

Autophagy

The protease activity of human ATG4B is regulated by reversible oxidative modification.

Authors - Xueping Zheng
humanWB,IF

Nat Commun

ASO therapy rescues NOTCH2NLC GGC repeat expansion-induced genomic damage, 3D chromatin structural abnormalities, and senescence.

Authors - Mengjie Li

Reviews

    5.0 out of 5
Add a review

1 verified customer reviews

What customers say

One reviewer used this antibody at a 1:1000 dilution for immunofluorescence on human HeLa cells and gave it a perfect 5-star rating. They reported using it for nucleolar staining and described the signal as very strong and specific, indicating excellent performance in their application.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Tatyana (Verified Customer) (12-04-2023)

Was used for nucleolar staining, very strong specific signal

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Human / HeLa cells
B23/NPM1 Antibody Immunofluorescence validation (1:1000 dilution) in Human / HeLa cells (Cat no:60096-1-Ig)
Loading...
||
New chat

Able™

正在加载,请稍候...