Tested Applications
| Positive WB detected in | HSC-T6 cells, C6 cells, HeLa cells, HepG2 cells, LNCaP cells, NIH/3T3 cells, RAW 264.7 cells, ROS1728 cells, MCF-7 cells, HEK-293 cells, Jurkat cells, K-562 cells |
| Positive IHC detected in | human breast cancer tissue, human colon cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells, MCF-7 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:200-1:1000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:400-1:1600 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
60096-1-Ig targets B23/NPM1 in WB, IHC, IF/ICC, IP, CoIP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag7415 Product name: Recombinant human B23 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-293 aa of BC002398 Sequence: MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEEEEDVKLLSISGKRSAPGGGSKVPQKKVKLAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVKKSIRDTPAKNAQKSNQNGKDSKPSSTPRSKGQESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKS Predict reactive species |
| Full Name | nucleophosmin (nucleolar phosphoprotein B23, numatrin) |
| Calculated Molecular Weight | 33 kDa |
| Observed Molecular Weight | 35-38 kDa |
| GenBank Accession Number | BC002398 |
| Gene Symbol | NPM1 |
| Gene ID (NCBI) | 4869 |
| RRID | AB_2155162 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | P06748 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Nucleophosmin (NPM1,B23) is a putative ribosome assembly factor with a high affinity for peptides containing nuclear localization signals (NLSs). The transport of proteins across the nuclear envelope is a selective, multistep process involving several cytoplasmic factors. Proteins must be recognized as import substrates, dock at the nuclear pore complex and translocate across the nuclear envelope in an ATP-dependent fashion. Several cytosolic and nuclear proteins that are central to this process have been identified. The 38 kDa nuclear protein nucleophosmin is involved in ribosomal assembly and rRNA transport. It is an abundant protein that is highly phosphorylated by Cdc2 kinase during mitosis.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for B23/NPM1 antibody 60096-1-Ig | Download protocol |
| IHC protocol for B23/NPM1 antibody 60096-1-Ig | Download protocol |
| WB protocol for B23/NPM1 antibody 60096-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
60096-1-Ig is an anti-NPM1 (Nucleophosmin 1) antibody with 65 total citations. Citations appear in journals including Nature Communications, Nature Metabolism, Molecular Cell, Brain, Science Advances, Cell Reports, Oncogene, and iScience, among others. Research fields span oncology (various solid tumors and leukemias), neurodegenerative diseases (ALS, FTD, Alzheimer's), nucleolar biology, RNA processing, ribosome biogenesis, signal transduction, and epigenetics. Applications include WB, IF, IHC, IP, CoIP, and ChIP.
| Species | Application | Title |
|---|---|---|
Signal Transduct Target Ther PKMYT1 kinase ameliorates cisplatin sensitivity in osteosarcoma | ||
J Hepatol Nucleolin lactylation contributes to intrahepatic cholangiocarcinoma pathogenesis via RNA splicing regulation of MADD | ||
Nat Metab Myc-mediated SDHA acetylation triggers epigenetic regulation of gene expression and tumorigenesis. | ||
Mol Neurodegener Nuclear speckle specific hnRNP D-like prevents age- and AD-related cognitive decline by modulating RNA splicing. | ||
Autophagy The protease activity of human ATG4B is regulated by reversible oxidative modification. | ||
Nat Commun ASO therapy rescues NOTCH2NLC GGC repeat expansion-induced genomic damage, 3D chromatin structural abnormalities, and senescence. |
Reviews
What customers say
One reviewer used this antibody at a 1:1000 dilution for immunofluorescence on human HeLa cells and gave it a perfect 5-star rating. They reported using it for nucleolar staining and described the signal as very strong and specific, indicating excellent performance in their application.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Tatyana (Verified Customer) (12-04-2023) | Was used for nucleolar staining, very strong specific signal
![]() |




































