Tested Applications
Positive WB detected in | HeLa cells, PC-3 cells, HSC-T6 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:1000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
27009-1-AP targets Nurim in WB, ELISA applications and shows reactivity with human, rat samples.
Tested Reactivity | human, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag25501 Product name: Recombinant human NRM protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-98 aa of BC039865 Sequence: MAPALLLIPAALASFILAFGTGVEFVRFTSLRPLLGGIPESGGPDARQGWLAALQDRSILAPLAWDLGLLLLFVGQHSLMAAERVKAWTSRYFGVLQR Predict reactive species |
Full Name | nurim (nuclear envelope membrane protein) |
Calculated Molecular Weight | 29 kDa |
Observed Molecular Weight | 25 kDa |
GenBank Accession Number | BC039865 |
Gene Symbol | NRM |
Gene ID (NCBI) | 11270 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q8IXM6 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for Nurim antibody 27009-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |