Tested Applications
| Positive WB detected in | A431 cells, mouse liver tissue, human kidney tissue, human liver tissue, mouse colon tissue, mouse kidney tissue, rat kidney tissue, rat liver tissue |
| Positive IP detected in | mouse liver tissue |
| Positive IHC detected in | human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | MCF-7 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:16000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:800 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 2 publications below |
| WB | See 448 publications below |
| IHC | See 75 publications below |
| IF | See 126 publications below |
| IP | See 2 publications below |
Product Information
13409-1-AP targets Occludin in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, pig, canine, chicken, bovine |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag4057 Product name: Recombinant human Occludin protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 269-522 aa of BC029886 Sequence: RKMDRYDKSNILWDKEHIYDEQPPNVEEWVKNVSAGTQDVPSPPSDYVERVDSPMAYSSNGKVNDKRFYPESSYKSTPVPEVVQELPLTSPVDDFRQPRYSSGGNFETPSKRAPAKGRAGRSKRTEQDHYETDYTTGGESCDELEEDWIREYPPITSDQQRQLYKRNFDTGLQEYKSLQSELDEINKELSRLDKELDDYREESEEYMAAADEYNRLKQVKGSADYKSKKNHCKQLKSKLSHIKKMVGDYDRQKT Predict reactive species |
| Full Name | occludin |
| Calculated Molecular Weight | 522 aa, 59 kDa |
| Observed Molecular Weight | 59 kDa |
| GenBank Accession Number | BC029886 |
| Gene Symbol | Occludin |
| Gene ID (NCBI) | 4950 |
| RRID | AB_2156308 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q16625 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Occludin is an integral membrane protein located at the tight junction. It is a tetraspanin protein with four transmembrane domains, intracellular N and C termini and two extracellular loops. Occludin plays a role in the formation and regulation of the tight junction paracellular permeability barrier. Occludin can exist in different isoforms, owing to modifications at the posttranscriptional and posttranslational levels, the monomeric occludin migrates as 53-65 kDa on SDS-PAGE (PMID: 22083955; 19457074).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Occludin antibody 13409-1-AP | Download protocol |
| IHC protocol for Occludin antibody 13409-1-AP | Download protocol |
| IP protocol for Occludin antibody 13409-1-AP | Download protocol |
| WB protocol for Occludin antibody 13409-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Nat Commun Dubosiella newyorkensis modulates immune tolerance in colitis via the L-lysine-activated AhR-IDO1-Kyn pathway | ||
Cell Host Microbe Gut microbiome dysbiosis contributes to abdominal aortic aneurysm by promoting neutrophil extracellular trap formation | ||
J Clin Invest A20 regulates lymphocyte adhesion in murine neuroinflammation by restricting endothelial ICOSL expression in the CNS | ||
Adv Sci (Weinh) OR11H1 Missense Variant Confers the Susceptibility to Vogt-Koyanagi-Harada Disease by Mediating Gadd45g Expression | ||
Hepatology Basolateral CD147 induces hepatocyte polarity loss by E-cadherin ubiquitination and degradation in hepatocellular carcinoma progress. | ||
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Kin (Verified Customer) (07-24-2025) | great antibody for both western blotting and IF staining.
|
FH Tom (Verified Customer) (02-03-2023) | 1:5000 on murine intestinal protein extract for 2h in TBST
|
FH Wu (Verified Customer) (12-09-2021) | The antibody gives a good detection of Occludin
![]() |
FH Tom (Verified Customer) (09-21-2021) | Gave decent results with IHC at a concentration of 1:300-1:400 for mouse intestinal tissue
|
FH Amy (Verified Customer) (05-22-2019) | I approached Proteintech for guidance with regards to dilutions of this antibody, and with their help I optimized the protocol in good time. Very helpful!
|
FH JIMMY (Verified Customer) (03-26-2019) | This antibody offers a good detection of Occludin on mouse brain endothelial cell line, bEnd3 cells, through IHC.
|


























