• Featured Product
  • KD/KO Validated

Occludin Polyclonal antibody

Occludin Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 13409-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (4)

Applications

WB, IHC, IF/ICC, IP, ELISA

OCLN

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA431 cells, mouse liver tissue, human kidney tissue, human liver tissue, mouse colon tissue, mouse kidney tissue, rat kidney tissue, rat liver tissue
Positive IP detected inmouse liver tissue
Positive IHC detected inhuman breast cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inMCF-7 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:16000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:800
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

13409-1-AP targets Occludin in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, pig, canine, chicken, bovine
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag4057

Product name: Recombinant human Occludin protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 269-522 aa of BC029886

Sequence: RKMDRYDKSNILWDKEHIYDEQPPNVEEWVKNVSAGTQDVPSPPSDYVERVDSPMAYSSNGKVNDKRFYPESSYKSTPVPEVVQELPLTSPVDDFRQPRYSSGGNFETPSKRAPAKGRAGRSKRTEQDHYETDYTTGGESCDELEEDWIREYPPITSDQQRQLYKRNFDTGLQEYKSLQSELDEINKELSRLDKELDDYREESEEYMAAADEYNRLKQVKGSADYKSKKNHCKQLKSKLSHIKKMVGDYDRQKT

Predict reactive species
Full Name occludin
Calculated Molecular Weight 522 aa, 59 kDa
Observed Molecular Weight 59 kDa
GenBank Accession NumberBC029886
Gene Symbol Occludin
Gene ID (NCBI) 4950
RRIDAB_2156308
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ16625
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Occludin is an integral membrane protein located at the tight junction. It is a tetraspanin protein with four transmembrane domains, intracellular N and C termini and two extracellular loops. Occludin plays a role in the formation and regulation of the tight junction paracellular permeability barrier. Occludin can exist in different isoforms, owing to modifications at the posttranscriptional and posttranslational levels, the monomeric occludin migrates as 53-65 kDa on SDS-PAGE (PMID: 22083955; 19457074).

Protocols

Product Specific Protocols
WB protocol for Occludin antibody 13409-1-APDownload protocol
IHC protocol for Occludin antibody 13409-1-APDownload protocol
IF protocol for Occludin antibody 13409-1-APDownload protocol
IP protocol for Occludin antibody 13409-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseIF

Nat Commun

Dubosiella newyorkensis modulates immune tolerance in colitis via the L-lysine-activated AhR-IDO1-Kyn pathway

Authors - Yanan Zhang
mouseIHC

Cell Host Microbe

Gut microbiome dysbiosis contributes to abdominal aortic aneurysm by promoting neutrophil extracellular trap formation

Authors - Zhenyu Tian

J Clin Invest

A20 regulates lymphocyte adhesion in murine neuroinflammation by restricting endothelial ICOSL expression in the CNS

Authors - Lisa Johann
humanWB

Adv Sci (Weinh)

OR11H1 Missense Variant Confers the Susceptibility to Vogt-Koyanagi-Harada Disease by Mediating Gadd45g Expression

Authors - Xingran Li
humanWB

Hepatology

Basolateral CD147 induces hepatocyte polarity loss by E-cadherin ubiquitination and degradation in hepatocellular carcinoma progress.

Authors - Meng Lu
mouseWB

J Exp Med

Brain endothelial TAK1 and NEMO safeguard the neurovascular unit.

Authors - Dirk A Ridder

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Kin (Verified Customer) (07-24-2025)

great antibody for both western blotting and IF staining.

  • Applications: Western Blot, Immunofluorescence
  • Cell Tissue Type: oesophageal barretts' cell lines
FH

Tom (Verified Customer) (02-03-2023)

1:5000 on murine intestinal protein extract for 2h in TBST

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:5000
  • Cell Tissue Type: Mouse intestines
FH

Wu (Verified Customer) (12-09-2021)

The antibody gives a good detection of Occludin

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:100
  • Cell Tissue Type: gut
Occludin Antibody Immunofluorescence validation (1:100 dilution) in gut (Cat no:13409-1-AP)
FH

Tom (Verified Customer) (09-21-2021)

Gave decent results with IHC at a concentration of 1:300-1:400 for mouse intestinal tissue

  • Applications: Immunohistochemistry
  • Primary Antibody Dilution: 1:300-1:400
  • Cell Tissue Type: Mouse intestinal tissue
FH

Amy (Verified Customer) (05-22-2019)

I approached Proteintech for guidance with regards to dilutions of this antibody, and with their help I optimized the protocol in good time. Very helpful!

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1:500
  • Cell Tissue Type: Mouse Colon
FH

JIMMY (Verified Customer) (03-26-2019)

This antibody offers a good detection of Occludin on mouse brain endothelial cell line, bEnd3 cells, through IHC.

  • Applications: Immunofluorescence,
Loading...