Occludin Monoclonal antibody

• Home
• Products
• Primary Antibodies
• Occludin Monoclonal antibody (66378-1-Ig)

• Featured Product
• KD/KO Validated

Occludin Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 66378-1-Ig

Clone No.1D3C4

Publications(219)

Reviews (3)

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig and More (3)

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

OCLN, 1D3C4

• 

  WB analysis using 66378-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 66378-1-Ig (Occludin antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Jurkat using 66378-1-Ig

  WB result of Occludin antibody (66378-1-Ig; 1:600; incubated at room temperature for 1.5 hours) with sh-Control and sh-Occludin transfected Jurkat cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of pig colon using 66378-1-Ig

  pig colon tissue were subjected to SDS PAGE followed by western blot with 66378-1-Ig (Occludin antibody) at dilution of 1:50000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of LNCaP using 66378-1-Ig

  LNCaP cells were subjected to SDS PAGE followed by western blot with 66378-1-Ig (Occludin antibody) at dilution of 1:50000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 66378-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 66378-1-Ig (Occludin antibody) at dilution of 1:50000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 66378-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 66378-1-Ig (Occludin antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung cancer using 66378-1-Ig

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 66378-1-Ig (Occludin antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung cancer using 66378-1-Ig

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 66378-1-Ig (Occludin antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse kidney using 66378-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 66378-1-Ig (Occludin antibody) at dilution of 1:400 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse kidney using 66378-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 66378-1-Ig (Occludin antibody) at dilution of 1:400 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of MCF-7 using 66378-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed MCF-7 cells using Occludin antibody (66378-1-Ig, Clone: 1D3C4 ) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: HUVEC cells, Jurkat cells, mouse colon tissue, LNCaP cells, U2OS cells, pig colon tissue, rat colon tissue, 4T1 cells, HEK-293 cells
• Positive IHC detected in: human lung cancer tissue, mouse kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: MCF-7 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

66378-1-Ig targets Occludin in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Cited Reactivity: human, mouse, rat, pig, canine, bovine, sheep
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4057

  Product name: Recombinant human Occludin protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 270-522 aa of BC029886

  Sequence: KMDRYDKSNILWDKEHIYDEQPPNVEEWVKNVSAGTQDVPSPPSDYVERVDSPMAYSSNGKVNDKRFYPESSYKSTPVPEVVQELPLTSPVDDFRQPRYSSGGNFETPSKRAPAKGRAGRSKRTEQDHYETDYTTGGESCDELEEDWIREYPPITSDQQRQLYKRNFDTGLQEYKSLQSELDEINKELSRLDKELDDYREESEEYMAAADEYNRLKQVKGSADYKSKKNHCKQLKSKLSHIKKMVGDYDRQKT

• Full Name: occludin
• Calculated Molecular Weight: 522 aa, 59 kDa
• Observed Molecular Weight: 59 kDa
• GenBank Accession Number: BC029886
• Gene Symbol: Occludin
• Gene ID (NCBI): 4950
• RRID: AB_2881755
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q16625
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Occludin is an integral membrane protein located at the tight junction. It is a tetraspanin protein with four transmembrane domains, intracellular N and C termini and two extracellular loops. Occludin plays a role in the formation and regulation of the tight junction paracellular permeability barrier. Occludin can exist in different isoforms, owing to modifications at the posttranscriptional and posttranslational levels, the monomeric occludin migrates as 53-65 kDa on SDS-PAGE (PMID: 22083955; 19457074).

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IF	Autophagy; High-fat diet exacerbates experimental colitis by inhibiting lysosomal function via the STAT3-TFEB Axis.; Authors - Haodong He
mouse	IF	Autophagy; Streptococcus pneumoniae extracellular vesicles aggravate alveolar epithelial barrier disruption via autophagic degradation of OCLN (occludin); Authors - Luqing Cui
mouse	WB	Nat Commun; The gut microbe Bacteroides fragilis ameliorates renal fibrosis in mice; Authors - Wei Zhou
human	IF	Circ Res; Endothelial BACE1 Impairs Cerebral Small Vessels via Tight Junctions and eNOS.; Authors - Haoyue Zhou
mouse	IHC,IF	J Adv Res; Sedanolide alleviated DSS-induced colitis by modulating the intestinal FXR-SMPD3 pathway in mice; Authors - Shengjie Li
mouse,human	WB	Cardiovasc Diabetol; Pgk1 activation restores endothelial metabolic homeostasis to alleviate vascular aging and atherosclerosis.; Authors - Jinhong Lu

Reviews

4.3 out of 5

3 verified customer reviews

What customers say

Automatically generated from the verified customer reviews below by Able AI.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

Ipsita (Verified Customer) (07-14-2026)

Worked great for detection in mouse tissue

• Applications: Western Blot
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: Mouse vaginal column tissue

Saba (Verified Customer) (07-25-2022)

The quality of the band is very good and you can easily find the specific band on your membrane.

• Applications: Western Blot

Doriane (Verified Customer) (08-25-2019)

Satisfying antibody used for automated Western-blot Wes (Protein Simple)

• Applications: Western Blot, Other,
• Primary Antibody Dilution: Automated Western Blot Wes 1/400
• Cell Tissue Type: Caco-2/TC7 cell line