• Featured Product
  • KD/KO Validated

Occludin Monoclonal antibody, PBS Only (Capture/Detector)

Occludin Monoclonal Antibody for WB, IHC, Cytometric bead array, Indirect ELISA
Cat No. 66378-1-PBS
Clone No.1D3C4

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, Cytometric bead array, Indirect ELISA

OCLN, 1D3C4

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

66378-1-PBS targets Occludin as part of a matched antibody pair:

MP51160-1: 66378-2-PBS capture and 66378-1-PBS detection (validated in Cytometric bead array)

MP51160-3: 66378-1-PBS capture and 66378-4-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat, pig
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag4057

Product name: Recombinant human Occludin protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 269-522 aa of BC029886

Sequence: RKMDRYDKSNILWDKEHIYDEQPPNVEEWVKNVSAGTQDVPSPPSDYVERVDSPMAYSSNGKVNDKRFYPESSYKSTPVPEVVQELPLTSPVDDFRQPRYSSGGNFETPSKRAPAKGRAGRSKRTEQDHYETDYTTGGESCDELEEDWIREYPPITSDQQRQLYKRNFDTGLQEYKSLQSELDEINKELSRLDKELDDYREESEEYMAAADEYNRLKQVKGSADYKSKKNHCKQLKSKLSHIKKMVGDYDRQKT

Predict reactive species
Full Name occludin
Calculated Molecular Weight 522 aa, 59 kDa
Observed Molecular Weight 59 kDa
GenBank Accession NumberBC029886
Gene Symbol Occludin
Gene ID (NCBI) 4950
RRIDAB_2881755
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ16625
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Occludin is an integral membrane protein located at the tight junction. It is a tetraspanin protein with four transmembrane domains, intracellular N and C termini and two extracellular loops. Occludin plays a role in the formation and regulation of the tight junction paracellular permeability barrier. Occludin can exist in different isoforms, owing to modifications at the posttranscriptional and posttranslational levels, the monomeric occludin migrates as 53-65 kDa on SDS-PAGE (PMID: 22083955; 19457074).

Loading...
||
New chat Able
正在加载,请稍候...