• Featured Product
  • KD/KO Validated

CDKN2A/P16-INK4A Polyclonal antibody

CDKN2A/P16-INK4A Polyclonal Antibody for WB, IHC, FC (Intra), IP, ELISA
Cat No. 10883-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, dog and More (5)

Applications

WB, IHC, FC (Intra), IP, CoIP, ELISA

p16, p16 INK4, P16 INK4A, p16-INK4, p16INK4A

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHEK-293 cells, HEK293 cells, HeLa cells, HepG2 cells, PC-3 cells
Positive IP detected inHEK-293 cells
Positive IHC detected inhuman cervical cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inMDCK cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:1000-1:4000
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

10883-1-AP targets CDKN2A/P16-INK4A in WB, IHC, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, dog samples.

Tested Reactivity human, dog
Cited Reactivityhuman, pig, rabbit, canine, monkey, bovine
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag1328

Product name: Recombinant human P16-INK4A protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 52-156 aa of BC021998

Sequence: MMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEELGHRDVARYLRAAAGGTRGSNHARIDAAEGPSDIPD

Predict reactive species
Full Name cyclin-dependent kinase inhibitor 2A
Calculated Molecular Weight 16 kDa
Observed Molecular Weight 16-18 kDa
GenBank Accession NumberBC021998
Gene Symbol CDKN2A
Gene ID (NCBI) 1029
RRIDAB_2078303
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP42771
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Background

p16 is an important cell cycle regulator and acts as a tumor suppressor. It may also be referred to as one of a number of synonyms, including p16INK4a and cyclin-dependent kinase inhibitor 2A.

 What is the molecular weight of P16?

16kDa. P16 is encoded by the CDKN2A gene in humans and is a chain comprising 148 amino acids.

What is the function of p16?

P16 inhibits cells from progressing from G1 into S phase, binding to cyclin-dependent kinase 4 (CDK4) and inhibiting its kinase ability, so that it cannot phosphorylate the retinoblastoma tumor suppressor (RB). Without this phosphorylation, RB does not activate downstream genes, so the G1/S checkpoint cannot be passed and the cell does not proliferate (PMID: 8259215).

 What is the role of p16 in senescence?

In senescence, cells are irreversibly arrested in the cell cycle. P16 is expressed more highly in aging tissue, is associated with intrinsic cellular aging signals such as telomere shortening, and can therefore be used as a marker of senescence (PMID: 9244355; PMID: 19535234). Due to its role in cell cycle arrest, p16 drives the initiation and maintenance of a cellular senescent phenotype.

 What is the role of p16 in cancer?

As a negative regulator of proliferation, p16 is a known tumor suppressor. Mutations in the CDKN2A gene that lead to inactivation of p16 protein have been associated with an increased risk of cancer and are often observed in primary tumors and in cancer cell lines (PMID: 9508208). The inactivation of p16 has been shown to be a key early stage of tumor progression. In a small number of tumor types that are caused by the human papilloma virus (HPV), p16 is in fact overexpressed when RB is inactivated, releasing p16 and causing an accumulation (PMID: 21297668).


Protocols

Product Specific Protocols
IF protocol for CDKN2A/P16-INK4A antibody 10883-1-APDownload protocol
IHC protocol for CDKN2A/P16-INK4A antibody 10883-1-APDownload protocol
IP protocol for CDKN2A/P16-INK4A antibody 10883-1-APDownload protocol
WB protocol for CDKN2A/P16-INK4A antibody 10883-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
IHC

Nature

Senolytic CAR T cells reverse senescence-associated pathologies.

Authors - Corina Amor
humanWB

Science

PI(3,4)P2-mediated cytokinetic abscission prevents early senescence and cataract formation.

Authors - Federico Gulluni
humanWB

Signal Transduct Target Ther

Glibenclamide targets MDH2 to relieve aging phenotypes through metabolism-regulated epigenetic modification

Authors - Zhifan Mao
human

Nat Genet

Early TP53 alterations engage environmental exposures to promote gastric premalignancy in an integrative mouse model.

Authors - Nilay S Sethi
WB

Cancer Cell

mTORC1 Activation Blocks Braf(V600E)-Induced Growth Arrest but Is Insufficient for Melanoma Formation.

Authors - William Damsky
humanWB

Circulation

Vascular Smooth Muscle Cell Senescence Promotes Atherosclerosis and Features of Plaque Vulnerability.

Authors - Julie Wang

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Mathew (Verified Customer) (08-19-2025)

Worked well for western blots of 2DD primary foreskin fibroblast that had undergone confluence induced senescence.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: 2DD Primary Foreskin Fibroblast
FH

Vikas (Verified Customer) (04-23-2024)

Highly recommended, to use 1:1000 dilution for Western bloating.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: SH-SY5Y cell line
FH

Vikas (Verified Customer) (04-23-2024)

Used p16 antibody for western-bolting at the dilution 1:10000, antibody worked at best. Thank you, highly recommended it.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: SH-SY5Y cell line
FH

Susanne (Verified Customer) (10-11-2022)

blocking: ROTIblock Incubation over night 4°C

  • Applications: Western Blot
  • Primary Antibody Dilution: 1 : 1000
  • Cell Tissue Type: mouse skin tissue
FH

Malak (Verified Customer) (04-22-2021)

Unfortunately, with this antibody, I didn't get a bad at 16 KD, however it was higher (around 20 KD). The suppliers were so professional and offered their help to optimize this antibody.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1/1000
  • Cell Tissue Type: Huh7 cells extract
FH

Joshua (Verified Customer) (03-12-2020)

MDCKs fixed in 4% paraformaldehyde and stained overnight at 4 C. Excellent, bright stain.

  • Applications: Immunofluorescence,
  • Primary Antibody Dilution: 1:500
  • Cell Tissue Type: MDCK
CDKN2A/P16-INK4A Antibody Immunofluorescence, validation (1:500 dilution) in MDCK (Cat no:10883-1-AP)
FH

Kyle (Verified Customer) (02-28-2019)

Clean bands, low background

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: small cell lung cancer
Loading...
||
New chat Able
正在加载,请稍候...