Tested Applications
Positive WB detected in | HeLa cells, NIH/3T3 cells, HepG2 cells, MCF-7 cells, Jurkat cells |
Positive IP detected in | NIH/3T3 cells |
Positive IHC detected in | human breast cancer tissue, human lung cancer tissue, human colon cancer tissue, human ovary tumor tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF-P detected in | mouse testis tissue |
Positive IF/ICC detected in | HepG2 cells |
Positive FC (Intra) detected in | MCF-7 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:1000-1:8000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 3 publications below |
WB | See 228 publications below |
IHC | See 19 publications below |
IF | See 6 publications below |
IP | See 2 publications below |
CoIP | See 2 publications below |
Product Information
25614-1-AP targets P27; KIP1 in WB, IHC, IF/ICC, IF-P, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Cited Reactivity | human, mouse, rat, canine, bovine, sheep |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag22582 Product name: Recombinant human P27; KIP1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 44-198 aa of BC001971 Sequence: DLEKHCRDMEEASQRKWNFDFQNHKPLEGKYEWQEVEKGSLPEFYYRPPRPPKGACKVPAQESQDGSGSRPAAPLIGAPANSEDTHLVDPKTDPSDSQTGLAEQCAGIRKRPATDDSSTQNKRANRTEENVSDGSPNAGSVEQTPKKPGLRRRQT Predict reactive species |
Full Name | cyclin-dependent kinase inhibitor 1B (p27, Kip1) |
Calculated Molecular Weight | 198 aa, 22 kDa |
Observed Molecular Weight | 27 kDa |
GenBank Accession Number | BC001971 |
Gene Symbol | p27 Kip1/CDKN1B |
Gene ID (NCBI) | 1027 |
RRID | AB_2880161 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P46527 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
CDKN1B, also named as P27 or KIP1, is a cyclin-dependent kinase inhibitor, which shares a limited similarity with CDK inhibitor CDKN1A/p21. P27 binds to and prevents the activation of cyclin E-CDK2 or cyclin D-CDK4 complexes, and thus controlling cell cycle progression at G1. The degradation of this protein, which is triggered by its CDK dependent phosphorylation and subsequent ubiquitination by SCF complexes, is required for the cellular transition from quiescence to the proliferative state. Downregulation of P27 has been implicated in the progression of several malignancies, including lung cancer, hepatocellular carcinoma, salivary cancer, oral squamous cell carcinomas, and gastric cancer.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for P27; KIP1 antibody 25614-1-AP | Download protocol |
IHC protocol for P27; KIP1 antibody 25614-1-AP | Download protocol |
IF protocol for P27; KIP1 antibody 25614-1-AP | Download protocol |
IP protocol for P27; KIP1 antibody 25614-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Gastroenterology Intestinal PPARα Protects Against Colon Carcinogenesis via Regulation of Methyltransferases DNMT1 and PRMT6. | ||
Cell Res DNA damage triggers tubular endoplasmic reticulum extension to promote apoptosis by facilitating ER-mitochondria signaling. | ||
Mol Cancer LncRNA TROJAN promotes proliferation and resistance to CDK4/6 inhibitor via CDK2 transcriptional activation in ER+ breast cancer. | ||
Mol Cancer CircGPR137B/miR-4739/FTO feedback loop suppresses tumorigenesis and metastasis of hepatocellular carcinoma. | ||
Small Synergistic Silencing of Skp2 by siRNA Self-Assembled Nanoparticles as a Therapeutic Strategy for Advanced Prostate Cancer. |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Malak (Verified Customer) (04-22-2021) | The optimal incubation period is 1.5 hr at room temperature. Avoid incubating the antibody overnight as it may result in aspecific signals.
|
FH Susmita (Verified Customer) (09-17-2020) | Antibody is working very good for WB
|
FH Joshua (Verified Customer) (07-27-2019) | Cells fixed in 4% paraformaldehyde and stained at 4C overnight. Decent staining with some background in rabbit cells. Nuclear localization as expected.
![]() |